PGR5.2 (Potri.008G171000) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol PGR5.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G05620 180 / 1e-59 PGR5 proton gradient regulation 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G066900 232 / 2e-80 AT2G05620 173 / 7e-57 proton gradient regulation 5 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023734 176 / 6e-58 AT2G05620 193 / 5e-65 proton gradient regulation 5 (.1)
Lus10011777 172 / 2e-56 AT2G05620 194 / 2e-65 proton gradient regulation 5 (.1)
PFAM info
Representative CDS sequence
>Potri.008G171000.1 pacid=42808214 polypeptide=Potri.008G171000.1.p locus=Potri.008G171000 ID=Potri.008G171000.1.v4.1 annot-version=v4.1
ATGGCTACTTCGATTTCTGCAACTGGGTTTCAGGGAGGTTTTGGGACTTCATTTAAGGGAAGTTGGGGTGCTTCAATCGTTGGTGAAGACTATGCCATGT
TGATCAAGTCAGTGCCAAACCATGTAAGAGTTGGGAAGCCAGTGAAATTGCCTCCCATGATGAAGAACGTTAATGAAGGAAAGGGTGTTTTTGCCCCTAT
TGTTGTTATCACGCGTCAAGCAATTGGCAAGAAAAGGTTCAATCAGCTAAGAGGCAAAGCAATTGCCTTGCACTCACAGGTGATTACCGAATTCTGCAGA
TCAATAGGAGCAGATCCAAAACAAAGGCAAGGACTGATTAGGTTGGCCAAGAAGAATGGGGAAAGACTTGGATTCCTTGCTTGA
AA sequence
>Potri.008G171000.1 pacid=42808214 polypeptide=Potri.008G171000.1.p locus=Potri.008G171000 ID=Potri.008G171000.1.v4.1 annot-version=v4.1
MATSISATGFQGGFGTSFKGSWGASIVGEDYAMLIKSVPNHVRVGKPVKLPPMMKNVNEGKGVFAPIVVITRQAIGKKRFNQLRGKAIALHSQVITEFCR
SIGADPKQRQGLIRLAKKNGERLGFLA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G05620 PGR5 proton gradient regulation 5 (... Potri.008G171000 0 1 PGR5.2
AT3G17609 bZIP HYH HY5-homolog (.1.2.3.4) Potri.010G004200 1.73 0.9610 HY5.1
AT5G05580 AtFAD8, SH1, FA... fatty acid desaturase 8 (.1.2) Potri.006G101500 2.00 0.9599 FAD3.2
AT1G78510 SPS1 solanesyl diphosphate synthase... Potri.001G380500 2.44 0.9646
AT5G60900 RLK1 receptor-like protein kinase 1... Potri.019G007700 4.24 0.9626
AT5G60900 RLK1 receptor-like protein kinase 1... Potri.019G007400 4.89 0.9586
AT5G65620 Zincin-like metalloproteases f... Potri.009G151300 5.74 0.9530
AT5G19855 AtRbcX2 homologue of cyanobacterial Rb... Potri.009G053300 6.48 0.9584
AT4G09350 NdhT, CRRJ NADH dehydrogenase-like comple... Potri.013G109000 7.41 0.9593
AT3G56010 unknown protein Potri.008G070700 8.83 0.9504
AT5G17230 PSY PHYTOENE SYNTHASE (.1.2.3) Potri.002G056800 9.00 0.9573

Potri.008G171000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.