Plant FIBer expression Database

Potri.008G174000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G13520 54 / 2e-11 SMAP1 small acidic protein 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G063100
[exp]
84 / 1e-23 AT4G13520 51 / 2e-10 small acidic protein 1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023702
[exp]
66 / 3e-16 AT4G13520 48 / 2e-09 small acidic protein 1 (.1)
Lus10004400
[exp]
64 / 2e-15 AT4G13520 52 / 5e-11 small acidic protein 1 (.1)
PFAM info
Representative CDS sequence
>Potri.008G174000.2 pacid=42807551 polypeptide=Potri.008G174000.2.p locus=Potri.008G174000 ID=Potri.008G174000.2.v4.1 annot-version=v4.1
ATGAGGCCGATGCAGGTAGACTTCTTCGCGGACATGGAGGATCAAGGATCAACAGTGGCTATGGACGTAGATGACGTGGACGCACTGGAGATGTTCGGGG
AGGGAGTCATCAACATGGAAAACAAACTTGCCGACGCCGATTTCTTCAACTATTTCGAAGACGATTTCGATGACACAGACATCAACTGA
AA sequence
>Potri.008G174000.2 pacid=42807551 polypeptide=Potri.008G174000.2.p locus=Potri.008G174000 ID=Potri.008G174000.2.v4.1 annot-version=v4.1
MRPMQVDFFADMEDQGSTVAMDVDDVDALEMFGEGVINMENKLADADFFNYFEDDFDDTDIN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G13520 SMAP1 small acidic protein 1 (.1) Potri.008G174000
[exp]
0 1
AT2G04230 FBD, F-box and Leucine Rich Re... Potri.004G020200
[exp]
1.41 0.8524
AT5G22280 unknown protein Potri.016G073500
[exp]
1.41 0.8516
AT3G58090 Disease resistance-responsive ... Potri.006G216000
[exp]
4.00 0.8123
AT2G33740 CUTA Nitrogen regulatory PII-like, ... Potri.002G103700
[exp]
5.29 0.7963 Pt-CUTA.1
AT1G71750 HGPT Hypoxanthine-guanine phosphori... Potri.005G198400
[exp]
6.00 0.8359
AT4G13520 SMAP1 small acidic protein 1 (.1) Potri.010G063100
[exp]
7.34 0.7886
AT1G79390 unknown protein Potri.008G081400
[exp]
7.74 0.7773
AT3G58500 PP2A-4, EP7, PP... protein phosphatase 2A-4 (.1) Potri.006G196100
[exp]
7.93 0.8165
AT4G20380 LSD1 LESION SIMULATING DISEASE, LSD... Potri.011G154800
[exp]
9.53 0.7998 LSD1.2
AT1G52600 Peptidase S24/S26A/S26B/S26C f... Potri.018G005800
[exp]
9.94 0.8057

Potri.008G174000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.