Potri.008G175500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67430 282 / 1e-98 Ribosomal protein L22p/L17e family protein (.1.2)
AT1G27400 282 / 1e-98 Ribosomal protein L22p/L17e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G060400 306 / 3e-108 AT1G67430 299 / 3e-105 Ribosomal protein L22p/L17e family protein (.1.2)
Potri.015G094400 300 / 9e-106 AT1G67430 324 / 4e-115 Ribosomal protein L22p/L17e family protein (.1.2)
Potri.012G096600 298 / 5e-105 AT1G27400 321 / 4e-114 Ribosomal protein L22p/L17e family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006421 275 / 2e-95 AT1G67430 315 / 1e-111 Ribosomal protein L22p/L17e family protein (.1.2)
Lus10015792 246 / 8e-77 AT1G67420 511 / 2e-168 Zn-dependent exopeptidases superfamily protein (.1.2)
Lus10037015 246 / 4e-76 AT1G67420 1104 / 0.0 Zn-dependent exopeptidases superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00237 Ribosomal_L22 Ribosomal protein L22p/L17e
Representative CDS sequence
>Potri.008G175500.1 pacid=42806828 polypeptide=Potri.008G175500.1.p locus=Potri.008G175500 ID=Potri.008G175500.1.v4.1 annot-version=v4.1
ATGGTGAAGTACTCTAGGGAGCCTGATAATCCCACTAAGTCCTGCAAAGCAAGGGGCGGTGACCTCAGAGTTCATTTTAAGAATACAAGGGAGACAGCTT
TTGCTTTGAGGAAGTTGCCTTTGGCCAAGGCCAAGAGGTACCTGGAAGATGTCCTGGCTCACAAGCAGGCCATTCCATTCCGACGTTTCTGTGGTGGAGT
TGGGCGAACTGCTCAAGCAAAGAACAGGCACTCAAACGGACAAGGACGCTGGCCTGCCAAGTCTGCAAGGTTCATCCTGGACTTGCTCAAGAATGCTGAG
AGCAACGCTGAGCTCAAGGGTTTGGATGTGGATGCACTCTACATATCTCACATCCAGGTGAATCAGGCACAGAAGCAGAGGCGTCGTACATATAGGGCAC
ATGGAAGAATTAATCCTTACATGTCCAGCCCGTGCCACATTGAGTTGGTTTTGTCTGAGAAGGAAGAGCCAGTTAAGAAAGAGCCTGAGACCCAGATAGC
AACCAGCAAGTCAAAGAAGTCGCAAGCTTCTTCTTGA
AA sequence
>Potri.008G175500.1 pacid=42806828 polypeptide=Potri.008G175500.1.p locus=Potri.008G175500 ID=Potri.008G175500.1.v4.1 annot-version=v4.1
MVKYSREPDNPTKSCKARGGDLRVHFKNTRETAFALRKLPLAKAKRYLEDVLAHKQAIPFRRFCGGVGRTAQAKNRHSNGQGRWPAKSARFILDLLKNAE
SNAELKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELVLSEKEEPVKKEPETQIATSKSKKSQASS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G67430 Ribosomal protein L22p/L17e fa... Potri.008G175500 0 1
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Potri.002G140400 3.00 0.9477 Pt-RPS11.5
AT5G27700 Ribosomal protein S21e (.1) Potri.013G017600 5.65 0.9338
AT3G05590 RPL18 ribosomal protein L18 (.1) Potri.005G023500 5.74 0.9280 Pt-RPL18.12
AT5G02960 Ribosomal protein S12/S23 fami... Potri.008G044400 8.06 0.9244 Pt-RPS23.3
AT4G27090 Ribosomal protein L14 (.1) Potri.010G069900 8.24 0.9272
AT3G59680 unknown protein Potri.019G112300 10.53 0.8773
AT3G53740 Ribosomal protein L36e family ... Potri.012G142600 16.43 0.9070
AT5G59850 Ribosomal protein S8 family pr... Potri.001G118100 17.88 0.9120 Pt-WRP15.2
AT3G05560 Ribosomal L22e protein family ... Potri.014G128800 18.00 0.9212 RPL22.2
Potri.017G139650 19.54 0.7912

Potri.008G175500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.