Potri.008G176201 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G043800 62 / 9e-13 AT2G34930 383 / 7e-119 disease resistance family protein / LRR family protein (.1)
Potri.015G028600 61 / 1e-12 AT2G34930 387 / 1e-119 disease resistance family protein / LRR family protein (.1)
Potri.015G025100 61 / 1e-12 AT2G34930 361 / 3e-109 disease resistance family protein / LRR family protein (.1)
Potri.015G025300 59 / 1e-11 AT2G34930 314 / 1e-91 disease resistance family protein / LRR family protein (.1)
Potri.015G025800 58 / 3e-11 AT2G34930 375 / 3e-115 disease resistance family protein / LRR family protein (.1)
Potri.015G024500 57 / 4e-11 AT2G34930 315 / 7e-92 disease resistance family protein / LRR family protein (.1)
Potri.003G196766 57 / 4e-11 AT2G34930 257 / 7e-76 disease resistance family protein / LRR family protein (.1)
Potri.010G107000 57 / 6e-11 AT2G34930 504 / 1e-163 disease resistance family protein / LRR family protein (.1)
Potri.015G024600 56 / 1e-10 AT2G34930 415 / 5e-130 disease resistance family protein / LRR family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016325 64 / 3e-13 AT2G34930 206 / 4e-59 disease resistance family protein / LRR family protein (.1)
Lus10002742 58 / 2e-11 AT1G58190 399 / 6e-124 receptor like protein 9 (.1.2)
Lus10033931 54 / 3e-10 AT2G34930 81 / 2e-17 disease resistance family protein / LRR family protein (.1)
Lus10039512 49 / 4e-08 AT2G15080 379 / 2e-116 receptor like protein 19 (.1.2)
Lus10039529 44 / 2e-06 AT2G34930 427 / 1e-134 disease resistance family protein / LRR family protein (.1)
Lus10002754 43 / 5e-06 AT1G08590 139 / 2e-35 Leucine-rich receptor-like protein kinase family protein (.1)
Lus10002743 42 / 2e-05 AT2G34930 476 / 6e-153 disease resistance family protein / LRR family protein (.1)
Lus10039531 42 / 2e-05 AT2G34930 485 / 2e-156 disease resistance family protein / LRR family protein (.1)
Lus10039522 41 / 2e-05 AT2G34930 165 / 1e-44 disease resistance family protein / LRR family protein (.1)
Lus10016339 40 / 4e-05 AT2G34930 495 / 2e-160 disease resistance family protein / LRR family protein (.1)
PFAM info
Representative CDS sequence
>Potri.008G176201.1 pacid=42807564 polypeptide=Potri.008G176201.1.p locus=Potri.008G176201 ID=Potri.008G176201.1.v4.1 annot-version=v4.1
ATGTGTGACATCACCAACAATGGGAAAGCTGGATTCAAAAGTTACAAAGAGAAAGGTGAAGATGATCCTGAAAATCTATGGTTTTACATGGGCATGGGAT
CAGGATTTATAGTGGGATTTTGGGCTGTTTGTGGAAGCTTGGCCATCAAGAAGTCTTGGAGACATGCCTATTTCAAGTTTCTTGATGGAGTGGAAGATAA
GCTATTTATGTTCATTACGCACAGCTCACTGGCAATTAAAATGAAGATGGCAAGAAACTAG
AA sequence
>Potri.008G176201.1 pacid=42807564 polypeptide=Potri.008G176201.1.p locus=Potri.008G176201 ID=Potri.008G176201.1.v4.1 annot-version=v4.1
MCDITNNGKAGFKSYKEKGEDDPENLWFYMGMGSGFIVGFWAVCGSLAIKKSWRHAYFKFLDGVEDKLFMFITHSSLAIKMKMARN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.008G176201 0 1
AT4G10490 2-oxoglutarate (2OG) and Fe(II... Potri.011G150100 1.73 0.8790
AT2G24640 UBP19 ubiquitin-specific protease 19... Potri.018G009500 2.82 0.8783
AT5G51720 2 iron, 2 sulfur cluster bindi... Potri.015G132500 6.63 0.8435
AT5G41110 unknown protein Potri.012G104200 7.00 0.8883
AT1G04560 AWPM-19-like family protein (.... Potri.017G113000 7.61 0.8877
Potri.008G195401 10.48 0.8478
AT3G62080 SNF7 family protein (.1.2) Potri.002G186100 14.35 0.7518
AT4G24530 O-fucosyltransferase family pr... Potri.002G105800 14.89 0.8139
AT1G24190 SNL3, AtSin3 ARABIDOPSIS THALIANA SIN3 HOMO... Potri.017G056201 19.89 0.8298
AT3G55530 SDIR1 SALT- AND DROUGHT-INDUCED RING... Potri.010G201500 20.14 0.8188

Potri.008G176201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.