Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20165 129 / 3e-41 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G058300 [exp] 143 / 6e-47 AT5G20165 128 / 4e-41 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003197 [exp] 132 / 1e-39 AT1G64520 335 / 5e-116 regulatory particle non-ATPase 12A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06842 [poplar] [flax] DUF1242 Protein of unknown function (DUF1242)
Representative CDS sequence Show only first row Show all	>Potri.008G176801.2 pacid=42808072 polypeptide=Potri.008G176801.2.p locus=Potri.008G176801 ID=Potri.008G176801.2.v4.1 annot-version=v4.1 ATGTCGGCACTGTTCAATTTCCATTCGTTTCTGACAGTTGTGCTGCTGGGGATTTGTACATGCACTTTTGTGAAGATGCACTTTCCAGCAATCCTTGAAC AGAGAAATGGATTTCGTGGTTTCTTTTGGAAAGCAGCCAGAATTGGTGAACGCTTGAGCCCCTGGGTTGCCGTAGGATGCTTCACAATGGGCGTGTCGAT AATTTTTTTCTGA
AA sequence Show only first row Show all	>Potri.008G176801.2 pacid=42808072 polypeptide=Potri.008G176801.2.p locus=Potri.008G176801 ID=Potri.008G176801.2.v4.1 annot-version=v4.1 MSALFNFHSFLTVVLLGICTCTFVKMHFPAILEQRNGFRGFFWKAARIGERLSPWVAVGCFTMGVSIIFF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G20165			unknown protein		Potri.008G176801 [exp]	0	1
AT1G69980			unknown protein		Potri.008G191700 [exp]	1.41	0.8817
AT4G29340		PRF4	profilin 4 (.1)		Potri.018G057600 [exp]	2.00	0.8898	PRO1.3
AT2G22370			unknown protein		Potri.007G095300 [exp]	3.87	0.8012
AT5G14670		ATARFA1B	ADP-ribosylation factor A1B (....		Potri.013G005500 [exp]	4.47	0.8350
AT1G28410			unknown protein		Potri.004G048500 [exp]	6.16	0.7936
AT4G34720		ATVHA-C1, AVA-P...	VACUOLAR H+-PUMPING ATPASE C1,...		Potri.004G163400 [exp]	8.66	0.8589	AVAP5.1
AT3G09735			S1FA-like DNA-binding protein ...		Potri.006G130200 [exp]	10.58	0.8248	S1FA3.1
AT3G18820		RAB71, AtRABG3f...	RAB GTPase homolog G3F (.1)		Potri.009G115000 [exp]	10.67	0.7751	Pt-ACT2.1
AT1G48440			B-cell receptor-associated 31-...		Potri.012G042700 [exp]	12.68	0.7880
AT5G55290			ATPase, V0 complex, subunit E ...		Potri.001G359600 [exp]	15.23	0.7814

Compare expression of checked genes

Potri.008G176801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.