Plant FIBer expression Database

Potri.008G177400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G57810 223 / 6e-74 Cysteine proteinases superfamily protein (.1.2.3)
AT2G38025 73 / 5e-16 Cysteine proteinases superfamily protein (.1)
AT2G27350 45 / 5e-06 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G050900
[exp]
239 / 3e-79 AT3G57810 301 / 5e-101 Cysteine proteinases superfamily protein (.1.2.3)
Potri.006G057400
[exp]
229 / 1e-75 AT3G57810 308 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Potri.008G026100
[exp]
188 / 1e-59 AT3G57810 197 / 2e-61 Cysteine proteinases superfamily protein (.1.2.3)
Potri.010G234300
[exp]
186 / 3e-59 AT3G57810 195 / 9e-61 Cysteine proteinases superfamily protein (.1.2.3)
Potri.010G057750
[exp]
89 / 1e-23 AT3G57810 52 / 1e-09 Cysteine proteinases superfamily protein (.1.2.3)
Potri.016G110400
[exp]
77 / 8e-18 AT2G38025 276 / 1e-94 Cysteine proteinases superfamily protein (.1)
Potri.009G160100
[exp]
47 / 1e-06 AT2G27350 440 / 3e-150 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.004G196800
[exp]
44 / 3e-05 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015803
[exp]
243 / 2e-83 AT3G57810 215 / 3e-71 Cysteine proteinases superfamily protein (.1.2.3)
Lus10037002
[exp]
242 / 4e-83 AT3G57810 213 / 2e-70 Cysteine proteinases superfamily protein (.1.2.3)
Lus10020438
[exp]
228 / 2e-75 AT3G57810 290 / 3e-97 Cysteine proteinases superfamily protein (.1.2.3)
Lus10008986
[exp]
187 / 2e-59 AT3G57810 187 / 9e-58 Cysteine proteinases superfamily protein (.1.2.3)
Lus10028840
[exp]
187 / 2e-58 AT3G57810 194 / 4e-59 Cysteine proteinases superfamily protein (.1.2.3)
Lus10027758
[exp]
57 / 3e-10 AT2G38025 227 / 4e-75 Cysteine proteinases superfamily protein (.1)
Lus10005193
[exp]
49 / 5e-07 AT2G27350 549 / 0.0 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Potri.008G177400.2 pacid=42806679 polypeptide=Potri.008G177400.2.p locus=Potri.008G177400 ID=Potri.008G177400.2.v4.1 annot-version=v4.1
ATGCGTTTCTTTCCTACTCGCAAAATGCCGAGACCAGAAACTGCCCTCGGCATACCTGGAGATGGAAGATGTTTGTTTCGGTCTGTGGTTCATGGTGCTT
GCCTTAGGACTGGGAAACCATCTCCGAGTGAAAGCCTTGAGAAAGAACTAGCAGATGAGCTTAGAGATAAAGTTGCAGATGAATTTATTAAGAGGCGGAG
GGAAACTGAATGGTTTATTGAAGATGATTTTGACACTTATGTTGTCAAGATGAGACAGCCCCATGTTTGGGGAGGAGAGCCTGAGCTGCTCATGTCCTCA
CATGTCCTGAAGATGCCAATCACTGTATACATGCGAGATAGAAGTTCTGGTAGCCTTAAAATTATAGCTGAATATGGTCAAGAATATGGTAATGAGAATC
CTGTGCGTGTCCTGTATCACGGTTATGGGCACTATGATGCATTGCCCGGTCTGATTGGTGGTGCACAATCCAAGCAGTTCAAGAAAAGATGA
AA sequence
>Potri.008G177400.2 pacid=42806679 polypeptide=Potri.008G177400.2.p locus=Potri.008G177400 ID=Potri.008G177400.2.v4.1 annot-version=v4.1
MRFFPTRKMPRPETALGIPGDGRCLFRSVVHGACLRTGKPSPSESLEKELADELRDKVADEFIKRRRETEWFIEDDFDTYVVKMRQPHVWGGEPELLMSS
HVLKMPITVYMRDRSSGSLKIIAEYGQEYGNENPVRVLYHGYGHYDALPGLIGGAQSKQFKKR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G57810 Cysteine proteinases superfami... Potri.008G177400
[exp]
0 1
AT1G10630 ATARFA1F ADP-ribosylation factor A1F (.... Potri.005G142100
[exp]
2.82 0.9318 Pt-ARF1.5
AT3G07510 unknown protein Potri.014G176300
[exp]
6.00 0.9135
Potri.012G085800
[exp]
6.70 0.9054
Potri.012G085901
[exp]
7.21 0.9045
AT5G21910 unknown protein Potri.006G220500
[exp]
7.74 0.8856
AT4G37370 CYP81D8 "cytochrome P450, family 81, s... Potri.002G121100
[exp]
7.93 0.8935 CYP81B5,IFS1.33
AT3G58720 RING/U-box superfamily protein... Potri.014G139400
[exp]
8.94 0.8911
Potri.006G098500
[exp]
10.19 0.8818
AT5G54660 HSP20-like chaperones superfam... Potri.011G131800
[exp]
11.22 0.8713
AT3G62800 DRB4 double-stranded-RNA-binding pr... Potri.019G038184
[exp]
11.22 0.8801

Potri.008G177400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.