Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04130 231 / 3e-73 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT3G22670 135 / 1e-36 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G53700 85 / 1e-18 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63150 81 / 4e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G09900 80 / 4e-17 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT5G64320 81 / 5e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G59900 80 / 5e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G09820 79 / 1e-16 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G62910 78 / 3e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G19890 78 / 3e-16 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G055500 [exp] 363 / 2e-124 AT3G04130 566 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.010G084000 [exp] 141 / 1e-38 AT3G22670 489 / 3e-168 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.010G083900 [exp] 134 / 3e-36 AT3G22670 439 / 1e-148 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.010G083800 [exp] 115 / 2e-29 AT3G22670 428 / 3e-144 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G046000 [exp] 92 / 3e-21 AT1G63130 405 / 9e-133 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G013300 [exp] 89 / 5e-20 AT3G53700 1092 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G015900 [exp] 82 / 1e-17 AT5G64320 878 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G154800 [exp] 82 / 1e-17 AT4G20090 816 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.015G121700 [exp] 82 / 2e-17 AT4G19890 923 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036975 [exp] 235 / 1e-75 AT3G04130 473 / 2e-165 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10015827 [exp] 236 / 7e-75 AT3G04130 535 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10041193 [exp] 129 / 3e-34 AT3G22670 531 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10039056 [exp] 87 / 2e-19 AT5G64320 832 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10012037 [exp] 85 / 2e-18 AT2G15630 677 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10005303 [exp] 84 / 4e-18 AT1G30290 1037 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10006373 [exp] 83 / 8e-18 AT3G53700 1012 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10040633 [exp] 82 / 2e-17 AT3G61520 586 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10012328 [exp] 81 / 4e-17 AT3G53700 1010 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10034419 [exp] 78 / 3e-16 AT1G73400 684 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat CL0020 [poplar] [flax] TPR PF12854 [poplar] [flax] PPR_1 PPR repeat CL0020 [poplar] [flax] TPR PF13812 [poplar] [flax] PPR_3 Pentatricopeptide repeat domain
Representative CDS sequence Show only first row Show all	>Potri.008G179201.1 pacid=42806034 polypeptide=Potri.008G179201.1.p locus=Potri.008G179201 ID=Potri.008G179201.1.v4.1 annot-version=v4.1 ATGAAAGGGTATGCTTGCCACCCTTGTGTAATCAGTTACTCCACCATCATCTTATTCTATTGCCGCCAATACAACTTTTATAAGGTTTATGAGCTCCTTG ATGTGATGAAATGGAAGCACAAGGGTGCCCAACAAATGCTGTTACTTACACCACCATCACTGTTTTTTCTGGCCAAGTCACAAAATTTTGAGGAGGCTTT ACAACTAGCTCAGAGGATGAAGTCAGCTGAATGTAAACCTGATACGGTTTTTTACAATTCCCTGATGGGAGAGCTGGTCGATTTCAGAAGGCCGTTGATT TTTTTTGAGGAGATGCCAAATACAGGGGTCTCTCGTGATCCATCTACCTATAACTCCATGATTGCTATGCTCTGTCATGATGGTCAAGTATCAAAGGCCC TTTCTCTTCTCAAGCAGATGGCAACGTTGGCACATTGCAAGCTTGTTGGTCAGGCGTTCTACCCATTGCTTAAGGCATGCTTTAGAATTGGAGACATGAA TTTGTTGATTCAATTAATGGATGACATGGTGAAAAAGCATCAGCTAAGTCTTGATAGATCAGTCTATGCTCTTTTAATTCATGGCCTTTGCAGAGCAAAC AAATGCGAGTGGGCTTGCCATCTGTTCAAGGAAATGATCGGTAAAAATATAGTACCAAAATATCAAACATGTCATTTGCTTTTGGAGGAGGTCAAACTAA AGAATATGTATGATACTGCTGAGAAAATTGAAGATTTCATGAAAAAATTATAA
AA sequence Show only first row Show all	>Potri.008G179201.1 pacid=42806034 polypeptide=Potri.008G179201.1.p locus=Potri.008G179201 ID=Potri.008G179201.1.v4.1 annot-version=v4.1 MKGYACHPCVISYSTIILFYCRQYNFYKVYELLDVMKWKHKGAQQMLLLTPPSLFFLAKSQNFEEALQLAQRMKSAECKPDTVFYNSLMGELVDFRRPLI FFEEMPNTGVSRDPSTYNSMIAMLCHDGQVSKALSLLKQMATLAHCKLVGQAFYPLLKACFRIGDMNLLIQLMDDMVKKHQLSLDRSVYALLIHGLCRAN KCEWACHLFKEMIGKNIVPKYQTCHLLLEEVKLKNMYDTAEKIEDFMKKL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G04130			Tetratricopeptide repeat (TPR)...		Potri.008G179201 [exp]	0	1
AT2G20710			Tetratricopeptide repeat (TPR)...		Potri.013G133000 [exp]	1.73	0.8899
AT4G33780			unknown protein		Potri.001G289600 [exp]	3.60	0.8027
AT5G07900			Mitochondrial transcription te...		Potri.015G038500 [exp]	5.47	0.8403
AT2G44850			unknown protein		Potri.002G137300 [exp]	8.71	0.8348
AT5G58210			hydroxyproline-rich glycoprote...		Potri.018G151900 [exp]	10.95	0.8033
AT5G63480			unknown protein		Potri.012G099200 [exp]	11.53	0.8207
AT4G05440		EDA35	embryo sac development arrest ...		Potri.017G048600 [exp]	11.87	0.8363
AT2G38730			Cyclophilin-like peptidyl-prol...		Potri.003G194500 [exp]	12.24	0.8262
AT5G52380			VASCULAR-RELATED NAC-DOMAIN 6 ...		Potri.015G144600 [exp]	13.78	0.7952
					Potri.001G265000 [exp]	15.49	0.7996

Compare expression of checked genes

Potri.008G179201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.