Potri.008G185350 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G036280 64 / 9e-16 ND /
Potri.003G072250 62 / 7e-15 ND /
Potri.016G085101 61 / 2e-14 ND /
Potri.013G056750 57 / 4e-13 ND /
Potri.016G076050 56 / 8e-13 ND /
Potri.003G072050 52 / 4e-11 ND /
Potri.011G027001 51 / 6e-11 ND /
Potri.004G152750 50 / 2e-10 ND /
Potri.008G012050 50 / 3e-10 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.008G185350.1 pacid=42806133 polypeptide=Potri.008G185350.1.p locus=Potri.008G185350 ID=Potri.008G185350.1.v4.1 annot-version=v4.1
ATGCCAATGATGTTTTTTCATTTTTTAAAAATTATTTTTGACATCAGCACATCAAAACGATCCAAAAAGTACAAACTGCACTCAATTTTAGCAAAAAAAA
AAAAAAATTTGAAATTCGGTGAAAAGCAGGTTCAACCGCAGAACCAAACAGCCCCTAAATGTCATGTTGATTTGCCACTCTCCTTGTATCCTTCGATGGA
CTTTTAG
AA sequence
>Potri.008G185350.1 pacid=42806133 polypeptide=Potri.008G185350.1.p locus=Potri.008G185350 ID=Potri.008G185350.1.v4.1 annot-version=v4.1
MPMMFFHFLKIIFDISTSKRSKKYKLHSILAKKKKNLKFGEKQVQPQNQTAPKCHVDLPLSLYPSMDF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.008G185350 0 1
Potri.019G001550 9.00 0.8964
AT2G27330 RNA-binding (RRM/RBD/RNP motif... Potri.009G160300 9.38 0.8214
AT5G01660 unknown protein Potri.008G074200 13.11 0.8215
AT5G24270 ATSOS3, CBL4, S... CALCINEURIN B-LIKE PROTEIN 4, ... Potri.015G013200 17.02 0.8921
Potri.011G144433 17.08 0.7774
AT3G17380 TRAF-like family protein (.1) Potri.008G199400 18.16 0.8866
AT3G30387 Protein of unknown function (D... Potri.004G110681 19.44 0.8865
Potri.010G199150 21.35 0.8864
Potri.005G070800 22.80 0.7205
Potri.006G216950 25.25 0.8813

Potri.008G185350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.