Potri.008G185800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67856 127 / 2e-38 RING/U-box superfamily protein (.1)
AT1G24580 109 / 7e-32 RING/U-box superfamily protein (.1)
AT3G61460 77 / 2e-18 BRH1 brassinosteroid-responsive RING-H2 (.1)
AT2G04240 72 / 1e-16 XERICO RING/U-box superfamily protein (.1.2)
AT1G63840 59 / 2e-11 RING/U-box superfamily protein (.1)
AT2G01150 58 / 2e-11 RHA2B RING-H2 finger protein 2B (.1)
AT1G72200 57 / 2e-10 RING/U-box superfamily protein (.1)
AT1G15100 56 / 2e-10 RHA2A RING-H2 finger A2A (.1)
AT1G63170 57 / 3e-10 Zinc finger, C3HC4 type (RING finger) family protein (.1)
AT4G32600 57 / 4e-10 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G047100 214 / 6e-73 AT1G67856 133 / 4e-41 RING/U-box superfamily protein (.1)
Potri.014G170400 81 / 3e-20 AT2G04240 181 / 3e-59 RING/U-box superfamily protein (.1.2)
Potri.007G086300 72 / 2e-16 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1)
Potri.014G087700 69 / 3e-15 AT3G61460 220 / 2e-74 brassinosteroid-responsive RING-H2 (.1)
Potri.005G081300 66 / 3e-14 AT2G01150 75 / 1e-17 RING-H2 finger protein 2B (.1)
Potri.007G086100 64 / 1e-13 AT2G01150 71 / 3e-16 RING-H2 finger protein 2B (.1)
Potri.005G081200 64 / 1e-13 AT1G15100 74 / 3e-17 RING-H2 finger A2A (.1)
Potri.010G133200 62 / 3e-13 AT3G61460 69 / 3e-15 brassinosteroid-responsive RING-H2 (.1)
Potri.010G133300 62 / 3e-13 AT3G61460 69 / 2e-15 brassinosteroid-responsive RING-H2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011416 120 / 5e-36 AT1G67856 124 / 1e-37 RING/U-box superfamily protein (.1)
Lus10007936 71 / 4e-16 AT2G01150 104 / 3e-29 RING-H2 finger protein 2B (.1)
Lus10032290 69 / 3e-15 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10024657 69 / 3e-15 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10013475 66 / 2e-14 AT2G01150 104 / 2e-29 RING-H2 finger protein 2B (.1)
Lus10019150 62 / 6e-13 AT2G04240 62 / 6e-13 RING/U-box superfamily protein (.1.2)
Lus10007937 62 / 6e-13 AT1G15100 100 / 2e-27 RING-H2 finger A2A (.1)
Lus10036378 61 / 4e-12 AT3G61460 210 / 5e-70 brassinosteroid-responsive RING-H2 (.1)
Lus10034407 60 / 5e-12 AT2G04240 61 / 2e-12 RING/U-box superfamily protein (.1.2)
Lus10037490 57 / 3e-10 AT3G16720 224 / 2e-70 TOXICOS EN LEVADURA 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.008G185800.1 pacid=42807646 polypeptide=Potri.008G185800.1.p locus=Potri.008G185800 ID=Potri.008G185800.1.v4.1 annot-version=v4.1
ATGGGGCTCTCAAGTTTCCCTGGTGCAGCAGGAGTGCTACCAGAGTTACTCATGAACACAATCTTATTAGTGGCTCTACTGAAAAACACGGTGAGGTCAG
TGCTGCAAGTGATGGCAGGTGCTAACTGGACACCTCCAAATTACGAGGAAGAGCCAGATGGACATCCACAAGAAAATGCAAGAGAGAGAAGAATGTCAAT
AACCCAGTTCAAGAGCTTGCAGCAGAATCATGATGGCACAAGCTATAGGGTTAGTACTGCAATGGAATGTTGTGTGTGTCTGTGTGGATTTCAAGCTGAA
GAAGAGGTGAGTGAGCTGCATTGCAAGCATTTCTTCCACAGAGGTTGTTTAGACAAGTGGTTTGATAACAAACAGGCTACTTGCCCTCTTTGTCGATCTA
TCATTTTATTAGATTCATAA
AA sequence
>Potri.008G185800.1 pacid=42807646 polypeptide=Potri.008G185800.1.p locus=Potri.008G185800 ID=Potri.008G185800.1.v4.1 annot-version=v4.1
MGLSSFPGAAGVLPELLMNTILLVALLKNTVRSVLQVMAGANWTPPNYEEEPDGHPQENARERRMSITQFKSLQQNHDGTSYRVSTAMECCVCLCGFQAE
EEVSELHCKHFFHRGCLDKWFDNKQATCPLCRSIILLDS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G67856 RING/U-box superfamily protein... Potri.008G185800 0 1
AT5G63905 unknown protein Potri.014G015866 5.91 0.7912
AT2G41290 SSL2 strictosidine synthase-like 2 ... Potri.006G040900 8.66 0.7563
AT2G28370 Uncharacterised protein family... Potri.004G211400 8.71 0.8150
AT2G43330 ATINT1 inositol transporter 1 (.1) Potri.017G032400 10.77 0.8134
AT1G26320 Zinc-binding dehydrogenase fam... Potri.017G003950 12.40 0.7802
AT3G61180 RING/U-box superfamily protein... Potri.014G075000 13.85 0.7480
AT1G71950 Proteinase inhibitor, propepti... Potri.013G112800 14.42 0.7645
AT5G11950 LOG8 LONELY GUY 8, Putative lysine ... Potri.001G005400 15.16 0.7362
AT1G69800 Cystathionine beta-synthase (C... Potri.017G053600 16.43 0.8037
AT1G63260 TET10 tetraspanin10 (.1.2.3) Potri.001G107200 17.14 0.8107

Potri.008G185800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.