Potri.008G185900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G047000 76 / 1e-19 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036864 54 / 4e-11 ND /
Lus10006216 53 / 1e-10 ND /
Lus10006665 52 / 3e-09 AT1G49320 177 / 3e-53 unknown seed protein like 1 (.1)
PFAM info
Representative CDS sequence
>Potri.008G185900.1 pacid=42806371 polypeptide=Potri.008G185900.1.p locus=Potri.008G185900 ID=Potri.008G185900.1.v4.1 annot-version=v4.1
ATGCCACTCACAAACTGTCCCAAACACACCAACCAACACCGTGCCAAACACCATAGAAACAATCCGGAGACCATGAATGATCGGCACCAGGATCCAGCAA
TATTCAACTACAATAGGCACAGCCAAGCTGTCGAGCATGAGAGAGGCGCCCAAGTATGTGTTAAGGTTGGTCATTACGTGGTTTGTGATGAGAGTGTTGA
TGAAGTAGCCGAGGAGTATATCAAGCTAAGGCATAAGAAGTTCGAATTAAGCAAGTCGATGTCTACGAAAGCTGGGTGA
AA sequence
>Potri.008G185900.1 pacid=42806371 polypeptide=Potri.008G185900.1.p locus=Potri.008G185900 ID=Potri.008G185900.1.v4.1 annot-version=v4.1
MPLTNCPKHTNQHRAKHHRNNPETMNDRHQDPAIFNYNRHSQAVEHERGAQVCVKVGHYVVCDESVDEVAEEYIKLRHKKFELSKSMSTKAG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.008G185900 0 1
AT5G14750 MYB WER1, WER, AtMY... WEREWOLF 1, WEREWOLF, myb doma... Potri.003G064600 3.00 0.6785
AT1G15670 Galactose oxidase/kelch repeat... Potri.001G007000 11.87 0.6261
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Potri.006G252200 15.32 0.6091
AT5G05700 ATATE1, DLS1, A... DELAYED LEAF SENESCENCE 1, arg... Potri.008G067000 23.83 0.5986 Pt-ATE1.3
AT3G48530 KING1 SNF1-related protein kinase re... Potri.012G097000 27.27 0.6162
AT1G49780 PUB26 plant U-box 26 (.1) Potri.007G105300 30.46 0.5764
AT4G17070 peptidyl-prolyl cis-trans isom... Potri.001G150300 33.54 0.5795
AT3G02875 ILR1 IAA-LEUCINE RESISTANT 1, Pepti... Potri.006G207400 44.49 0.5693 ILL1,Pt-ILR1.2
AT4G11650 ATOSM34 osmotin 34 (.1) Potri.001G102400 52.82 0.5561
AT4G35190 LOG5 LONELY GUY 5, Putative lysine ... Potri.005G248900 55.49 0.5434

Potri.008G185900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.