Potri.008G186200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67910 86 / 1e-23 unknown protein
AT1G24577 70 / 3e-17 unknown protein
AT5G55980 54 / 9e-11 serine-rich protein-related (.1)
AT5G20370 45 / 7e-07 serine-rich protein-related (.1)
AT3G13227 44 / 8e-07 serine-rich protein-related (.1)
AT3G56500 42 / 4e-06 serine-rich protein-related (.1)
AT5G25280 38 / 0.0003 serine-rich protein-related (.1.2)
AT5G11090 38 / 0.0003 serine-rich protein-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G046700 160 / 1e-52 AT1G67910 82 / 4e-22 unknown protein
Potri.018G079200 51 / 6e-10 AT1G67910 45 / 9e-08 unknown protein
Potri.001G371400 52 / 2e-09 AT5G55980 50 / 2e-08 serine-rich protein-related (.1)
Potri.002G250700 48 / 4e-08 AT3G56500 43 / 5e-06 serine-rich protein-related (.1)
Potri.018G023300 41 / 2e-05 AT5G11090 194 / 1e-62 serine-rich protein-related (.1)
Potri.006G060700 40 / 2e-05 AT5G11090 66 / 4e-14 serine-rich protein-related (.1)
Potri.006G159300 39 / 3e-05 AT1G24577 43 / 5e-07 unknown protein
Potri.006G258600 40 / 4e-05 AT5G25280 181 / 1e-57 serine-rich protein-related (.1.2)
Potri.006G060800 40 / 5e-05 AT5G25280 130 / 2e-37 serine-rich protein-related (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000442 67 / 7e-16 AT1G67910 56 / 1e-11 unknown protein
Lus10026701 65 / 3e-15 AT1G67910 56 / 5e-12 unknown protein
Lus10023227 48 / 3e-08 AT5G55980 69 / 3e-16 serine-rich protein-related (.1)
Lus10008880 48 / 3e-08 AT5G55980 63 / 1e-13 serine-rich protein-related (.1)
Lus10023632 45 / 3e-07 AT1G67910 48 / 1e-08 unknown protein
Lus10034901 44 / 1e-06 AT1G67910 49 / 6e-09 unknown protein
Lus10043215 40 / 1e-05 AT5G55980 44 / 8e-07 serine-rich protein-related (.1)
Lus10008808 42 / 2e-05 AT5G25280 153 / 2e-46 serine-rich protein-related (.1.2)
Lus10039998 42 / 2e-05 AT5G25280 157 / 3e-48 serine-rich protein-related (.1.2)
Lus10011094 40 / 2e-05 AT5G55980 44 / 1e-06 serine-rich protein-related (.1)
PFAM info
Representative CDS sequence
>Potri.008G186200.9 pacid=42806499 polypeptide=Potri.008G186200.9.p locus=Potri.008G186200 ID=Potri.008G186200.9.v4.1 annot-version=v4.1
ATGGAGAGAGGGCAGATATTCAACAAGGTCATGAAGGTAGAGATTCCATCAGAGACTGAAAGAATGTCGAGTGGTGGCACAAAGTTTACTTCTGGGCTTC
AAAGACAGTCAAGCGCTACAAAGAGCAATTGCCTATGCTCTCCAACCTCCCATGCTGGTTCTTTCCGGTGCAGGTTACACCGTGCCCCGAGCCTTCAAAG
AACCAAAAGCATTGACTCTGCTTCTCTTCGAGACTCTGAAACTAAGATCAATACGACAGCTGATGGTGCTAGCAATTTAAACACAATTGAGGCCCAGTAA
AA sequence
>Potri.008G186200.9 pacid=42806499 polypeptide=Potri.008G186200.9.p locus=Potri.008G186200 ID=Potri.008G186200.9.v4.1 annot-version=v4.1
MERGQIFNKVMKVEIPSETERMSSGGTKFTSGLQRQSSATKSNCLCSPTSHAGSFRCRLHRAPSLQRTKSIDSASLRDSETKINTTADGASNLNTIEAQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G67910 unknown protein Potri.008G186200 0 1
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Potri.004G147000 4.24 0.7700
AT2G32260 ATCCT1 phosphorylcholine cytidylyltra... Potri.001G159400 5.65 0.7747
AT5G40870 UKL1, ATUK/UPRT... URIDINE KINASE-LIKE 1, uridine... Potri.001G332100 7.07 0.7802
AT3G27027 Protein of unknown function (D... Potri.001G328701 12.48 0.7726
AT3G05700 Drought-responsive family prot... Potri.005G020900 14.42 0.7445
AT1G22710 SUT1, ATSUC2, S... SUCROSE TRANSPORTER 1, ARABIDO... Potri.019G085800 15.29 0.7205 SUC2.1
AT1G25330 bHLH HAF, bHLH075, C... HALF FILLED, CESTA, basic heli... Potri.017G115300 15.96 0.7404
AT3G24200 FAD/NAD(P)-binding oxidoreduct... Potri.001G051200 18.02 0.6881
AT2G38450 unknown protein Potri.010G182400 25.61 0.6787
AT1G03670 ankyrin repeat family protein ... Potri.019G101700 28.56 0.7721

Potri.008G186200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.