Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G23750 239 / 1e-82 Nucleic acid-binding, OB-fold-like protein (.1) AT1G10590 210 / 2e-71 Nucleic acid-binding, OB-fold-like protein (.1.2.3) AT2G33845 201 / 3e-67 Nucleic acid-binding, OB-fold-like protein (.1) AT4G28440 181 / 1e-59 Nucleic acid-binding, OB-fold-like protein (.1) AT1G03810 164 / 6e-53 Nucleic acid-binding, OB-fold-like protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G041000 [exp] 263 / 2e-92 AT1G23750 234 / 1e-80 Nucleic acid-binding, OB-fold-like protein (.1) Potri.011G114800 [exp] 215 / 5e-73 AT2G33845 214 / 3e-72 Nucleic acid-binding, OB-fold-like protein (.1) Potri.001G396100 [exp] 212 / 7e-72 AT1G23750 194 / 5e-65 Nucleic acid-binding, OB-fold-like protein (.1) Potri.007G137600 [exp] 180 / 2e-59 AT4G28440 193 / 2e-64 Nucleic acid-binding, OB-fold-like protein (.1) Potri.017G014400 [exp] 177 / 2e-58 AT4G28440 194 / 9e-65 Nucleic acid-binding, OB-fold-like protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030617 [exp] 242 / 5e-84 AT1G23750 229 / 7e-79 Nucleic acid-binding, OB-fold-like protein (.1) Lus10030871 [exp] 239 / 9e-83 AT1G23750 226 / 2e-77 Nucleic acid-binding, OB-fold-like protein (.1) Lus10013010 [exp] 213 / 1e-72 AT1G23750 206 / 1e-69 Nucleic acid-binding, OB-fold-like protein (.1) Lus10029155 [exp] 213 / 1e-72 AT1G23750 206 / 1e-69 Nucleic acid-binding, OB-fold-like protein (.1) Lus10015411 [exp] 186 / 3e-61 AT2G33845 186 / 4e-61 Nucleic acid-binding, OB-fold-like protein (.1) Lus10013989 [exp] 183 / 3e-60 AT4G28440 186 / 3e-61 Nucleic acid-binding, OB-fold-like protein (.1) Lus10002172 [exp] 176 / 6e-58 AT2G33845 189 / 1e-62 Nucleic acid-binding, OB-fold-like protein (.1) Lus10039889 [exp] 171 / 9e-56 AT2G33845 185 / 1e-60 Nucleic acid-binding, OB-fold-like protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.008G189900.4 pacid=42808816 polypeptide=Potri.008G189900.4.p locus=Potri.008G189900 ID=Potri.008G189900.4.v4.1 annot-version=v4.1 ATGGCTGAAGAATCAAAACCGGGGTTGAGGAAGCCTGTATTCACCAAGGTTGAGCAGCTCCGCCCAGGCACTTTTGGCCACACTCTCACTGTGAAGGTTG TTAGTGTAAAGATGGTATTGCAGAAAGGGCGAGCTGATGGTCCTCAAGTACGCCAAATGAGAATTGCTGAATGTTTGGTTGGGGATGAGACTGGATTGAT TATCTTTACTGCTAGAAATGATCAAGTGGACTTGATGAAAGAGGATTCTACTGTGATCCTTCGCAATGCGAAAATCGACATGTTTAAAGGATCAATGAGG CTTGCTGTGGACAAGTGGGGCCGTGTTGAAGTCACTGAACCTGCTGATTTCACTGTGAAGGAAGATAACAACCTGTCGCTGATTGAATACGAACTTGTCA ACGTTGTTGAAGAATGA
AA sequence Show only first row Show all	>Potri.008G189900.4 pacid=42808816 polypeptide=Potri.008G189900.4.p locus=Potri.008G189900 ID=Potri.008G189900.4.v4.1 annot-version=v4.1 MAEESKPGLRKPVFTKVEQLRPGTFGHTLTVKVVSVKMVLQKGRADGPQVRQMRIAECLVGDETGLIIFTARNDQVDLMKEDSTVILRNAKIDMFKGSMR LAVDKWGRVEVTEPADFTVKEDNNLSLIEYELVNVVEE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G23750			Nucleic acid-binding, OB-fold-...		Potri.008G189900 [exp]	0	1
AT2G01470		ATSEC12, STL2P	SEC12P-like 2 protein (.1)		Potri.008G130300 [exp]	2.00	0.8310
AT3G01280		VDAC1, ATVDAC1	ARABIDOPSIS THALIANA VOLTAGE D...		Potri.010G033500 [exp]	3.16	0.7981	POR1.2
AT1G48440			B-cell receptor-associated 31-...		Potri.012G042700 [exp]	6.32	0.8013
AT1G06110		SKIP16	SKP1/ASK-interacting protein 1...		Potri.007G130900 [exp]	6.63	0.7404
AT3G18430			Calcium-binding EF-hand family...		Potri.018G103600 [exp]	7.07	0.7703
AT5G16450			Ribonuclease E inhibitor RraA/...		Potri.019G053800 [exp]	7.61	0.7600
AT5G59613			unknown protein		Potri.008G053000 [exp]	8.36	0.8379
AT4G34720		ATVHA-C1, AVA-P...	VACUOLAR H+-PUMPING ATPASE C1,...		Potri.004G163400 [exp]	9.69	0.8344	AVAP5.1
AT4G31300		PBA1	N-terminal nucleophile aminohy...		Potri.018G145900 [exp]	10.09	0.8097	Pt-PBA1.1
AT5G47570			unknown protein		Potri.001G122200 [exp]	12.60	0.8337

Compare expression of checked genes

Potri.008G189900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.