Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62470 381 / 4e-130 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G62540 377 / 2e-128 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G14820 377 / 2e-128 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G77360 135 / 2e-36 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G71060 132 / 4e-35 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G74900 114 / 6e-29 OTP43 organelle transcript processing defect 43, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G49730 115 / 8e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G73400 114 / 1e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G26500 113 / 2e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G39710 110 / 6e-27 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G121400 [exp] 478 / 3e-167 AT3G62470 737 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.010G114700 [exp] 137 / 8e-37 AT1G71060 679 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G181900 [exp] 133 / 1e-35 AT1G77360 723 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G176100 [exp] 120 / 2e-30 AT3G49730 783 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G046000 [exp] 112 / 9e-28 AT1G63130 405 / 9e-133 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G050400 [exp] 108 / 1e-26 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050500 [exp] 108 / 2e-26 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050120 [exp] 105 / 2e-26 AT1G12700 295 / 3e-94 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.016G025600 [exp] 107 / 5e-26 AT3G22470 426 / 3e-141 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015741 [exp] 393 / 7e-134 AT3G62470 725 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10003461 [exp] 388 / 6e-132 AT3G62470 718 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10001588 [exp] 132 / 1e-34 AT1G77360 679 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10001633 [exp] 129 / 5e-34 AT1G71060 602 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10019141 [exp] 124 / 6e-32 AT1G73400 672 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10019524 [exp] 120 / 1e-30 AT3G54980 716 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10034419 [exp] 119 / 3e-30 AT1G73400 684 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10030603 [exp] 108 / 2e-26 AT1G52640 672 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10011566 [exp] 108 / 3e-26 AT5G65820 826 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10030887 [exp] 107 / 5e-26 AT1G52640 658 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.008G191200.2 pacid=42806626 polypeptide=Potri.008G191250.1.p locus=Potri.008G191200 ID=Potri.008G191200.2.v4.1 annot-version=v4.1 ATGGGTGAAAAAAGGCTTTTGATGTTAGACACATTTTCCATTGCAATGAGAGCTTTTGCTGCTACAAAGGACAGGAAAAAGGCTGTTGGTATTTTTGAGT TAATGAAGAATCACAAATATAGAGTGGGTGTCGAGACCATTAATGCTCTGCTTGATAGTCTTGGGAGGGCCAAGCTTGGAAAAGAAGCTCAGGCACTATT TAGGAAGTTGGAAGGTAGGTTTATGCCAAATTTGAGGACATATACTATATTACTTAATGGATGGATTTGGAACGAGATGCTTGATGAGGGTTTTAAGCCT GATATTGTCACCAATACTATAATGCTTGAAGGGTTGTTAAGGAGTAAAAAGAGGTCTGATGCAATCAAGTTCTTTGAGGTCATTAAAGCCAAGGGCCCAT CACTTGATGTTCGGAGCTATATAATTTTGATCCGGGATCTATGCAAGCAAACTAAGATGAAAGAGGCAGTTGAATATTTTTATGAGATGATTGATTATGG TTTTCATCCTGATGCTGCAGTTTACACATGTTTGATGACAGGGTATGGGAATGATAAGAGGATGGACAAGGTTTATGAATTGTTGAAGGAGATGAAAGAA AAGGGTTGTCCACTTGATGGGAAAACTTATAATGCCCTTAACAAGTTGATGACCGGCCAGAGAATGCCAGGTGATGTATTGATGACCAGCCAGAGAATGT CAGATGATGCAGTGAGGATATATAAGAAGATGATTCAAAATGGAATTGAACCTTCAATCCACTCTTACAATATGATCATGAAATCTTACTTTCAAATAAG AAACTATGAAATGGAGAAGAAAATATGA
AA sequence Show only first row Show all	>Potri.008G191200.2 pacid=42806626 polypeptide=Potri.008G191250.1.p locus=Potri.008G191200 ID=Potri.008G191200.2.v4.1 annot-version=v4.1 MGEKRLLMLDTFSIAMRAFAATKDRKKAVGIFELMKNHKYRVGVETINALLDSLGRAKLGKEAQALFRKLEGRFMPNLRTYTILLNGWIWNEMLDEGFKP DIVTNTIMLEGLLRSKKRSDAIKFFEVIKAKGPSLDVRSYIILIRDLCKQTKMKEAVEYFYEMIDYGFHPDAAVYTCLMTGYGNDKRMDKVYELLKEMKE KGCPLDGKTYNALNKLMTGQRMPGDVLMTSQRMSDDAVRIYKKMIQNGIEPSIHSYNMIMKSYFQIRNYEMEKKI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G62470			Pentatricopeptide repeat (PPR)...		Potri.008G191200 [exp]	0	1
AT2G35160		SGD9, SUVH5	SET DOMAIN-CONTAINING PROTEIN ...		Potri.015G111884 [exp]	3.46	0.8479
AT2G32540		ATCSLB4, ATCSLB...	CELLULOSE SYNTHASE LIKE B4, ce...		Potri.014G155401 [exp]	5.65	0.8557
AT1G10417			unknown protein		Potri.008G190600 [exp]	11.31	0.8513
AT1G71090			Auxin efflux carrier family pr...		Potri.008G127700 [exp]	17.88	0.8246
AT4G14370			Disease resistance protein (TI...		Potri.011G014501 [exp]	21.02	0.8227
AT3G07330		ATCSLC6, ATCSLC...	CELLULOSE-SYNTHASE LIKE C6, Ce...		Potri.014G190701 [exp]	24.08	0.8384
AT3G18360			VQ motif-containing protein (....		Potri.012G055900 [exp]	24.81	0.8224
AT5G42480		ARC6	ACCUMULATION AND REPLICATION O...		Potri.002G027501 [exp]	25.98	0.8100
AT2G45740		PEX11D	peroxin 11D (.1.2.3)		Potri.009G133900 [exp]	29.69	0.8149
AT4G14770	CPP	ATTCX2	TESMIN/TSO1-like CXC 2 (.1)		Potri.018G030000 [exp]	31.30	0.8274

Compare expression of checked genes

Potri.008G191200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.