Plant FIBer expression Database

Potri.008G191500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G69970 64 / 2e-14 CLE26 CLAVATA3/ESR-RELATED 26 (.1.2)
AT3G28455 49 / 8e-09 CLE25 CLAVATA3/ESR-RELATED 25 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G039800
[exp]
101 / 2e-29 AT1G69970 72 / 8e-18 CLAVATA3/ESR-RELATED 26 (.1.2)
Potri.017G074600
[exp]
58 / 2e-12 AT3G28455 67 / 3e-16 CLAVATA3/ESR-RELATED 25 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010735
[exp]
66 / 4e-15 AT1G69970 66 / 3e-15 CLAVATA3/ESR-RELATED 26 (.1.2)
Lus10039460
[exp]
48 / 3e-08 AT3G28455 56 / 5e-12 CLAVATA3/ESR-RELATED 25 (.1)
Lus10005836
[exp]
40 / 9e-05 AT3G28455 49 / 3e-08 CLAVATA3/ESR-RELATED 25 (.1)
PFAM info
Representative CDS sequence
>Potri.008G191500.1 pacid=42806817 polypeptide=Potri.008G191500.1.p locus=Potri.008G191500 ID=Potri.008G191500.1.v4.1 annot-version=v4.1
ATGGGTGGTGGTGGTAGCTGCTCTTTGTCTTTCAAGGTGTTGCTGGCGGCAGTGGCAACGGTGATGCTTGTCTTGCTTTTGCTGGTTGGGGCCTTGGAAA
GTGGAGCGACCAAGATGACAGAAAGGACGCAAACCGTTCTGGATAGTATTGCTCAAGATGATCTCAGACGTCGTCATGAGGAGCTGATAGGAAGAGAGAA
GCTCGTTTACAATCCGGAGTTGGATCTCAACTTCGTGATGAACAAGAGAAAGGTTCCTAACGGGCCAGATCCCATTCATAACAGGAGAGCTGGGAACTCC
AGACGACCACCCGGACGAGCTTAG
AA sequence
>Potri.008G191500.1 pacid=42806817 polypeptide=Potri.008G191500.1.p locus=Potri.008G191500 ID=Potri.008G191500.1.v4.1 annot-version=v4.1
MGGGGSCSLSFKVLLAAVATVMLVLLLLVGALESGATKMTERTQTVLDSIAQDDLRRRHEELIGREKLVYNPELDLNFVMNKRKVPNGPDPIHNRRAGNS
RRPPGRA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G69970 CLE26 CLAVATA3/ESR-RELATED 26 (.1.2) Potri.008G191500
[exp]
0 1
AT1G69970 CLE26 CLAVATA3/ESR-RELATED 26 (.1.2) Potri.010G039800
[exp]
1.41 0.9501
AT2G18196 Heavy metal transport/detoxifi... Potri.011G149500
[exp]
3.46 0.9361
AT3G62950 Thioredoxin superfamily protei... Potri.014G134200
[exp]
10.67 0.9187
AT5G18970 AWPM-19-like family protein (.... Potri.008G200300
[exp]
11.04 0.9429
AT5G24318 O-Glycosyl hydrolases family 1... Potri.012G017800
[exp]
13.30 0.9383
AT1G22710 SUT1, ATSUC2, S... SUCROSE TRANSPORTER 1, ARABIDO... Potri.013G115200
[exp]
16.37 0.8936 Pt-SUT1.2
AT3G12090 TET6 tetraspanin6 (.1) Potri.010G220300
[exp]
16.70 0.9135
AT1G10630 ATARFA1F ADP-ribosylation factor A1F (.... Potri.005G142100
[exp]
18.76 0.9169 Pt-ARF1.5
AT3G18670 Ankyrin repeat family protein ... Potri.006G281700
[exp]
19.79 0.9019
AT3G01680 SEOR1, SEOb Sieve-Element-Occlusion-Relate... Potri.001G340600
[exp]
20.85 0.9280

Potri.008G191500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.