Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G59730 119 / 3e-35 ATH7 thioredoxin H-type 7 (.1) AT1G69880 118 / 7e-35 ATH8 thioredoxin H-type 8 (.1) AT5G39950 115 / 7e-34 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G45145 108 / 2e-31 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT3G51030 105 / 5e-30 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT5G42980 103 / 2e-29 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G19730 103 / 4e-29 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT3G17880 94 / 3e-23 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) AT3G56420 81 / 4e-20 Thioredoxin superfamily protein (.1) AT1G11530 79 / 1e-19 ATCXXS1 C-terminal cysteine residue is changed to a serine 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G076700 [exp] 129 / 4e-39 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Potri.007G018000 [exp] 107 / 6e-31 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G030000 [exp] 107 / 1e-30 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.005G232700 [exp] 104 / 7e-30 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.012G045000 [exp] 97 / 5e-25 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.015G036000 [exp] 97 / 1e-24 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.004G031700 [exp] 80 / 4e-20 AT1G11530 179 / 1e-59 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.006G110100 [exp] 76 / 2e-18 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.019G062000 [exp] 76 / 3e-18 AT3G08710 164 / 6e-53 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036695 [exp] 162 / 9e-52 AT5G39950 125 / 1e-37 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10037228 [exp] 159 / 7e-51 AT1G59730 128 / 6e-39 thioredoxin H-type 7 (.1) Lus10036696 [exp] 159 / 1e-50 AT1G59730 127 / 2e-38 thioredoxin H-type 7 (.1) Lus10037227 [exp] 157 / 5e-50 AT1G59730 129 / 3e-39 thioredoxin H-type 7 (.1) Lus10037225 [exp] 131 / 7e-40 AT1G69880 115 / 8e-34 thioredoxin H-type 8 (.1) Lus10036698 [exp] 125 / 2e-37 AT1G69880 113 / 5e-33 thioredoxin H-type 8 (.1) Lus10030666 [exp] 120 / 1e-35 AT5G39950 189 / 3e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10005258 [exp] 117 / 2e-34 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10000802 [exp] 109 / 2e-31 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10024293 [exp] 106 / 2e-30 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00085 [poplar] [flax] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Potri.008G194100.2 pacid=42808080 polypeptide=Potri.008G194100.2.p locus=Potri.008G194100 ID=Potri.008G194100.2.v4.1 annot-version=v4.1 ATGGAGTTCGGTTGGCCAGTTCTTCAGCGAGGAAGAACAGTGCAAACAAGCTTCTTTAATTTTGATCACTCCAATGGATTTCCATGCACAAAGCCAGCTG CTGGGGTTGTGGATGTCCATTCTGTAGGCGCATGGAGATCCTATTTCGAGGCCAACAAGCAAAACAACAAATTGCTGGTGATTGAATTCACGGCGACATG GTGTGGACCTTGCCGACACATGGAACAGACCATCAAGGACTTTGCTGCCAAGTACACAGACGTTGTGTTCATCAGGATTGACGTTGATGAATTGCAGCAT GTGGCTCAGCAATTCAATGTGACTACCATGCCAGCATTTTCACTCTTGAAGAAAGGGAAGATAGTTGACGAGGTAGCAGGGGTCAAGAAGAGTGAGCTTC AGAACAAGATTGAGAAGCATGGGATGATATGA
AA sequence Show only first row Show all	>Potri.008G194100.2 pacid=42808080 polypeptide=Potri.008G194100.2.p locus=Potri.008G194100 ID=Potri.008G194100.2.v4.1 annot-version=v4.1 MEFGWPVLQRGRTVQTSFFNFDHSNGFPCTKPAAGVVDVHSVGAWRSYFEANKQNNKLLVIEFTATWCGPCRHMEQTIKDFAAKYTDVVFIRIDVDELQH VAQQFNVTTMPAFSLLKKGKIVDEVAGVKKSELQNKIEKHGMI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G59730		ATH7	thioredoxin H-type 7 (.1)		Potri.008G194100 [exp]	0	1
AT2G38740			Haloacid dehalogenase-like hyd...		Potri.001G147400 [exp]	2.44	0.8443
AT1G14780			MAC/Perforin domain-containing...		Potri.010G104600 [exp]	7.48	0.8268
AT4G16790			hydroxyproline-rich glycoprote...		Potri.003G079900 [exp]	9.05	0.8471
AT1G65780			P-loop containing nucleoside t...		Potri.017G140601 [exp]	11.31	0.8423
AT4G29100	bHLH	bHLH068	basic helix-loop-helix (bHLH) ...		Potri.001G185900 [exp]	14.83	0.8338
					Potri.012G110500 [exp]	14.86	0.8183
AT1G28220		ATPUP3	purine permease 3 (.1)		Potri.002G099600 [exp]	16.43	0.8224
AT2G46660		CYP78A6	"cytochrome P450, family 78, s...		Potri.002G175200 [exp]	17.34	0.8281	Pt-CYP78.1
AT5G13520			peptidase M1 family protein (....		Potri.008G045900 [exp]	20.73	0.7881
AT1G31880		BRX, NIP3;1, NL...	BREVIS RADIX, DZC (Disease res...		Potri.003G101500 [exp]	21.90	0.8308

Compare expression of checked genes

Potri.008G194100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.