Potri.008G195700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G031700 81 / 3e-20 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.008G195700.2 pacid=42806031 polypeptide=Potri.008G195700.2.p locus=Potri.008G195700 ID=Potri.008G195700.2.v4.1 annot-version=v4.1
ATGGCCTCCTTTTGGTTTCTTACAGCACTTATTGTGCCTCTAGTGATCTTTCCTTCGCCTTCTTCTTCTTCTTCTTCCACTCAGCTAAATTCGAAAACCT
CTCCTTATCCTATCTCTACTTCACCAGCATTCTTAACCAATTCTCCTCCAATACCTCCTTTCCAAGAACTGTCACCGGACATTGCTCCACTACTGCCTTC
CCCTGGTGGTGTGCTGCCTTCCCCAACCGTATCGTCCGTTCCCACCATTCCATCCACCCCAAGCCCGCCTAATCCAGATGAGGTGGTCGCATCAGGGCCT
GATTCTGCGTTCTCGCCCCTAGGAGCATTGCTGGCTTCCTCTGCAGCACCTCGAAACTTGATAAACTCGGTTATTGTTGTGGGGTTTATAGCATATCGAT
CAATTCAGCTGTTTAAAATGTGA
AA sequence
>Potri.008G195700.2 pacid=42806031 polypeptide=Potri.008G195700.2.p locus=Potri.008G195700 ID=Potri.008G195700.2.v4.1 annot-version=v4.1
MASFWFLTALIVPLVIFPSPSSSSSSTQLNSKTSPYPISTSPAFLTNSPPIPPFQELSPDIAPLLPSPGGVLPSPTVSSVPTIPSTPSPPNPDEVVASGP
DSAFSPLGALLASSAAPRNLINSVIVVGFIAYRSIQLFKM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.008G195700 0 1
AT5G55180 O-Glycosyl hydrolases family 1... Potri.011G094400 3.00 0.9336
AT3G61640 AGP20, ATAGP20 arabinogalactan protein 20 (.1... Potri.014G094800 4.47 0.9298 AGP20.1
AT4G18760 AtRLP51 receptor like protein 51 (.1) Potri.011G069500 6.24 0.9282
AT5G13710 CPH, SMT1 CEPHALOPOD, sterol methyltrans... Potri.001G263700 6.32 0.9255
AT3G54770 RNA-binding (RRM/RBD/RNP motif... Potri.010G216800 8.83 0.9205
AT2G26520 unknown protein Potri.014G035400 11.61 0.8905
Potri.006G055800 14.83 0.9117
AT1G09580 emp24/gp25L/p24 family/GOLD fa... Potri.001G210900 15.00 0.9233
AT5G03680 Trihelix PTL PETAL LOSS, Duplicated homeodo... Potri.008G025600 19.41 0.9089
AT2G16595 Translocon-associated protein ... Potri.004G168500 23.51 0.9189

Potri.008G195700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.