Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18900 448 / 3e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G06300 429 / 7e-153 P4H2, AT-P4H-2 prolyl 4-hydroxylase 2, P4H isoform 2 (.1) AT3G28480 354 / 5e-123 Oxoglutarate/iron-dependent oxygenase (.1.2) AT3G28490 329 / 1e-113 Oxoglutarate/iron-dependent oxygenase (.1) AT1G20270 255 / 2e-84 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G35810 248 / 1e-81 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G17720 242 / 4e-79 P4H5 prolyl 4-hydroxylase 5, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G66060 238 / 9e-78 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT4G25600 203 / 5e-64 Oxoglutarate/iron-dependent oxygenase (.1) AT2G43080 197 / 1e-61 AT-P4H-1 P4H isoform 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G075100 [exp] 362 / 5e-126 AT3G28480 436 / 3e-155 Oxoglutarate/iron-dependent oxygenase (.1.2) Potri.017G075300 [exp] 301 / 6e-103 AT3G28480 345 / 5e-120 Oxoglutarate/iron-dependent oxygenase (.1.2) Potri.005G108000 [exp] 253 / 1e-83 AT5G66060 405 / 1e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.007G060800 [exp] 238 / 3e-77 AT5G66060 349 / 6e-121 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.005G245300 [exp] 236 / 4e-77 AT1G20270 483 / 3e-174 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G027201 [exp] 224 / 7e-73 AT5G18900 204 / 3e-65 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.012G142800 [exp] 219 / 4e-70 AT4G25600 278 / 4e-93 Oxoglutarate/iron-dependent oxygenase (.1) Potri.002G232100 [exp] 189 / 9e-59 AT2G43080 456 / 4e-164 P4H isoform 1 (.1) Potri.007G052600 [exp] 176 / 2e-53 AT4G33910 353 / 4e-123 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012014 [exp] 502 / 0 AT5G18900 448 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10016271 [exp] 501 / 0 AT5G18900 444 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032183 [exp] 360 / 4e-125 AT3G28480 434 / 3e-154 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10014502 [exp] 330 / 2e-113 AT3G28480 398 / 4e-140 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10028404 [exp] 251 / 2e-82 AT5G66060 486 / 8e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10041857 [exp] 251 / 2e-82 AT5G66060 488 / 2e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10005620 [exp] 224 / 1e-71 AT1G20270 465 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10017249 [exp] 208 / 6e-65 AT1G20270 455 / 3e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10031048 [exp] 199 / 5e-63 AT2G43080 406 / 7e-145 P4H isoform 1 (.1) Lus10038855 [exp] 175 / 3e-52 AT4G25600 250 / 2e-81 Oxoglutarate/iron-dependent oxygenase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0213 [poplar] [flax] ShK-like PF01549 [poplar] [flax] ShK ShK domain-like CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Potri.008G197700.1 pacid=42808147 polypeptide=Potri.008G197700.1.p locus=Potri.008G197700 ID=Potri.008G197700.1.v4.1 annot-version=v4.1 ATGGCTACTACGATCTACCCTCGCCAGTTCCTGTTTCTACTGTCGATCTTTTCGATTCTCCATAAATCCATCTCTTATCCAGGTACTTCCAGCTCCATCA TCAACCCTGCCAAAGTCAAACAAGTCTCTTGGAAGCCAAGGGCATTTGTGTACGAAGGATTTCTAACAGACTTAGAATGCGATCACTTGATTTCTCTGGC CAAATCGGAGTTGAAAAGATCAGCAGTGGCTGATAATGAGAGTGGAAAGAGTAAACTTAGCGAAGTTCGAACCAGTTCTGGAATGTTTATCACTAAAGCA AAGGATCCAATTGTTGCTGGTATAGAGGACAAGATTGCAACATGGACTTTTCTTCCAAGAGAGAATGGTGAAGACATACAAGTGTTGAGATATGAGCATG GGCAGAAATATGATCCCCACTACGATTACTTTTCTGACAAGGTTAATATTGCCCGTGGTGGACACCGGGTGGCAACTGTACTCATGTATCTTACAGATGT GGAAAAGGGTGGTGAAACAGTGTTCCCCTCAGCTGAGGAACTTCCCCGTCGTAAAGCTTCTGTTAGTCATGAAGACCTTTCTGAATGTGCAAGGAAAGGA ATTGCAGTGAAACCACGTAGAGGGGATGCGCTTCTTTTCTTCAGTCTCTATCCAACTGCTGTTCCAGACACAAGCAGCATCCACGCAGGGTGCCCTGTGA TTGAAGGTGAGAAATGGTCCGCCACAAAGTGGATTCATGTAGACTCATTTGACAAGAACTTGGAAGCTGGTGGGAATTGCACTGATCAGAATGAAAGTTG TGGGAGGTGGGCCGCCCTTGGAGAATGCACCAAAAACGTCGAGTACATGGTTGGATCTTCAGGTCTTCCTGGATATTGTAGGAGGAGTTGTAAGGTATGT TAA
AA sequence Show only first row Show all	>Potri.008G197700.1 pacid=42808147 polypeptide=Potri.008G197700.1.p locus=Potri.008G197700 ID=Potri.008G197700.1.v4.1 annot-version=v4.1 MATTIYPRQFLFLLSIFSILHKSISYPGTSSSIINPAKVKQVSWKPRAFVYEGFLTDLECDHLISLAKSELKRSAVADNESGKSKLSEVRTSSGMFITKA KDPIVAGIEDKIATWTFLPRENGEDIQVLRYEHGQKYDPHYDYFSDKVNIARGGHRVATVLMYLTDVEKGGETVFPSAEELPRRKASVSHEDLSECARKG IAVKPRRGDALLFFSLYPTAVPDTSSIHAGCPVIEGEKWSATKWIHVDSFDKNLEAGGNCTDQNESCGRWAALGECTKNVEYMVGSSGLPGYCRRSCKVC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G18900			2-oxoglutarate (2OG) and Fe(II...		Potri.008G197700 [exp]	0	1
AT1G09630		ATRAB-A2A, ATRA...	ARABIDOPSIS RAB GTPASE A2A, RA...		Potri.003G004100 [exp]	2.00	0.8664
AT5G39510		ZIG1, SGR4, ATV...	SHOOT GRAVITROPSIM 4, VESICLE ...		Potri.017G087700 [exp]	9.53	0.8761
AT2G01140		PDE345	PIGMENT DEFECTIVE 345, Aldolas...		Potri.008G125900 [exp]	13.92	0.7908
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Potri.009G028200 [exp]	14.42	0.8566	Pt-ADF1.1
AT4G32150		ATVAMP711, VAMP...	vesicle-associated membrane pr...		Potri.018G025800 [exp]	16.06	0.8481	VAMP712.1
AT3G28715			ATPase, V0/A0 complex, subunit...		Potri.017G079200 [exp]	16.97	0.8362
AT2G37580			RING/U-box superfamily protein...		Potri.003G184800 [exp]	19.10	0.7973
AT3G13410			unknown protein		Potri.001G000900 [exp]	24.85	0.8602
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Potri.009G028100 [exp]	29.83	0.8508	ADF6,Pt-ADF.6
AT1G60970			SNARE-like superfamily protein...		Potri.001G352900 [exp]	33.98	0.8068

Compare expression of checked genes

Potri.008G197700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.