Plant FIBer expression Database

Potri.008G198500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G18920 90 / 2e-25 Cox19-like CHCH family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G028000
[exp]
125 / 1e-39 AT5G18920 88 / 7e-25 Cox19-like CHCH family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034006
[exp]
96 / 6e-28 AT5G18920 87 / 2e-24 Cox19-like CHCH family protein (.1)
PFAM info
Representative CDS sequence
>Potri.008G198500.1 pacid=42807624 polypeptide=Potri.008G198500.1.p locus=Potri.008G198500 ID=Potri.008G198500.1.v4.1 annot-version=v4.1
ATGGCTGAGCTACCAAAACAAGCATCCACATCTCCATTTCCACCACCTCGTCAGCAACCGCTTCACCAGAGCGATGCAGATGAGGATGATGACAACGTTA
AGCAACTCAAACAATGCTCCTCTCTCTACCTATCCCTACAGGATTGCCTTGTTAATTCCAATAGAAACTGGAAATCTTGCCAAAAGGAAATTCAAGCTTT
GAAGGCATGCAATGATAGGATGAAGAATGACAAGGGGAAGTGA
AA sequence
>Potri.008G198500.1 pacid=42807624 polypeptide=Potri.008G198500.1.p locus=Potri.008G198500 ID=Potri.008G198500.1.v4.1 annot-version=v4.1
MAELPKQASTSPFPPPRQQPLHQSDADEDDDNVKQLKQCSSLYLSLQDCLVNSNRNWKSCQKEIQALKACNDRMKNDKGK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G18920 Cox19-like CHCH family protein... Potri.008G198500
[exp]
0 1
AT3G11591 unknown protein Potri.008G011620
[exp]
2.64 0.8890
AT5G57280 RID2 root initiation defective 2, S... Potri.018G049800
[exp]
5.29 0.8346
AT2G36230 HISN3, APG10 ALBINO AND PALE GREEN 10, Aldo... Potri.004G090500
[exp]
10.58 0.8641
AT5G06620 SDG38, ATXR4 SET domain protein 38 (.1) Potri.006G196566
[exp]
17.40 0.8371
Potri.001G268000
[exp]
17.49 0.7973
AT5G64816 unknown protein Potri.005G156400
[exp]
23.45 0.8077
AT3G49000 RNA polymerase III subunit RPC... Potri.015G144900
[exp]
25.41 0.7959
AT5G59600 Tetratricopeptide repeat (TPR)... Potri.001G014900
[exp]
28.98 0.8253
AT1G48140 DPMS3 dolichol phosphate mannose syn... Potri.002G245800
[exp]
29.08 0.8111
AT4G15720 Tetratricopeptide repeat (TPR)... Potri.008G217000
[exp]
32.20 0.7723

Potri.008G198500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.