Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PtrMsrB3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G04830 221 / 1e-75 ATMSRB5 methionine sulfoxide reductase B5 (.1.2) AT4G21860 213 / 8e-72 MSRB2 methionine sulfoxide reductase B 2 (.1.2.3) AT4G04810 210 / 2e-71 ATMSRB4 methionine sulfoxide reductase B4 (.1) AT4G04800 206 / 4e-69 ATMSRB3 methionine sulfoxide reductase B3 (.1) AT4G21840 196 / 7e-66 ATMSRB8 methionine sulfoxide reductase B8 (.1) AT4G21830 195 / 1e-65 ATMSRB7 methionine sulfoxide reductase B7 (.1.2) AT4G21850 195 / 2e-65 ATMSRB9 methionine sulfoxide reductase B9 (.1.2) AT4G04840 184 / 9e-61 ATMSRB6 methionine sulfoxide reductase B6 (.1) AT1G53670 112 / 4e-32 MSRB1, ATMSRB1 methionine sulfoxide reductase B 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G080700 [exp] 230 / 4e-78 AT4G21860 253 / 7e-86 methionine sulfoxide reductase B 2 (.1.2.3) Potri.001G286500 [exp] 228 / 3e-77 AT4G21860 254 / 1e-86 methionine sulfoxide reductase B 2 (.1.2.3) Potri.011G114300 [exp] 100 / 1e-27 AT1G53670 231 / 7e-78 methionine sulfoxide reductase B 1 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009574 [exp] 243 / 2e-84 AT4G04830 225 / 2e-77 methionine sulfoxide reductase B5 (.1.2) Lus10007105 [exp] 226 / 9e-77 AT4G21860 251 / 2e-85 methionine sulfoxide reductase B 2 (.1.2.3) Lus10020486 [exp] 225 / 2e-76 AT4G21860 254 / 1e-86 methionine sulfoxide reductase B 2 (.1.2.3) Lus10013727 [exp] 108 / 2e-30 AT1G53670 253 / 2e-86 methionine sulfoxide reductase B 1 (.1.2) Lus10005593 [exp] 105 / 6e-29 AT1G53670 246 / 1e-83 methionine sulfoxide reductase B 1 (.1.2) Lus10007106 [exp] 57 / 3e-10 AT5G09630 150 / 1e-41 LisH/CRA/RING-U-box domains-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0080 [poplar] [flax] Beta-tent PF01641 [poplar] [flax] SelR SelR domain
Representative CDS sequence Show only first row Show all	>Potri.008G198600.7 pacid=42808356 polypeptide=Potri.008G198600.7.p locus=Potri.008G198600 ID=Potri.008G198600.7.v4.1 annot-version=v4.1 ATGGCAGGAGGAGGTTCGGTGCAGAAAACCGAGGAAGAATGGAGGGCTGTTCTCTCCCCCGAGCAGTTTCACATCCTTCGTGACAAGGGAACAGAGCCGA AATTCAGTGGAGAATATGATAAGTTTTTTGAGCAAGGAGTTTTCAATTGTGCTGGTTGTGGGACACCTCTTTACAAATCCACCACCAAATTCAACTCTGG CTGTGGCTGGCCTGCTTTCTATGAAGGTCTTCCTGCTGCGATAAATCGATCTCCGGACCCTGATGGGAGGAGAACTGAGATCACATGCGCAGCTTGTGGG GGGCATCTGGGTCATGTATTCAAGGGCGAGGGTCACAAGACTCCAACAGACGAACGCCATTGTGTCAACAGCATCTCTATCAAGTTTGTTTCTTCTCAGT GA
AA sequence Show only first row Show all	>Potri.008G198600.7 pacid=42808356 polypeptide=Potri.008G198600.7.p locus=Potri.008G198600 ID=Potri.008G198600.7.v4.1 annot-version=v4.1 MAGGGSVQKTEEEWRAVLSPEQFHILRDKGTEPKFSGEYDKFFEQGVFNCAGCGTPLYKSTTKFNSGCGWPAFYEGLPAAINRSPDPDGRRTEITCAACG GHLGHVFKGEGHKTPTDERHCVNSISIKFVSSQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G04830		ATMSRB5	methionine sulfoxide reductase...		Potri.008G198600 [exp]	0	1	PtrMsrB3
AT3G03980			NAD(P)-binding Rossmann-fold s...		Potri.019G033500 [exp]	2.23	0.7865
AT1G04290			Thioesterase superfamily prote...		Potri.004G134132 [exp]	4.24	0.7785
AT1G64850			Calcium-binding EF hand family...		Potri.013G072600 [exp]	12.00	0.7677
AT2G47490		ATNDT1	NAD+ transporter 1, ARABIDOPSI...		Potri.014G125600 [exp]	12.96	0.7722
AT1G77230			Tetratricopeptide repeat (TPR)...		Potri.002G076700 [exp]	15.42	0.7410
AT1G11440			unknown protein		Potri.011G032700 [exp]	16.61	0.7323
AT5G56180		ATARP8	actin-related protein 8 (.1.2)		Potri.001G471400 [exp]	17.88	0.7386	Pt-ARP8.1
AT3G17510		CIPK1, SnRK3.16	SNF1-RELATED PROTEIN KINASE 3....		Potri.010G002500 [exp]	21.74	0.7482
AT2G30942			Protein of unknown function (D...		Potri.002G263100 [exp]	21.81	0.7576
AT2G43940		ATHOL3, HOL3	HARMLESS TO OZONE LAYER 3, S-a...		Potri.017G007000 [exp]	22.58	0.7433

Compare expression of checked genes

Potri.008G198600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.