Potri.008G200300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G18970 187 / 2e-61 AWPM-19-like family protein (.1)
AT1G29520 100 / 1e-27 AWPM-19-like family protein (.1)
AT5G46530 98 / 1e-26 AWPM-19-like family protein (.1)
AT1G04560 57 / 2e-10 AWPM-19-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G200000 231 / 6e-79 AT5G18970 216 / 1e-72 AWPM-19-like family protein (.1)
Potri.011G077800 91 / 1e-23 AT5G46530 164 / 2e-52 AWPM-19-like family protein (.1)
Potri.001G354500 89 / 5e-23 AT1G29520 194 / 3e-64 AWPM-19-like family protein (.1)
Potri.010G064200 57 / 2e-10 AT1G04560 214 / 2e-71 AWPM-19-like family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001116 154 / 2e-48 AT5G18970 216 / 1e-72 AWPM-19-like family protein (.1)
Lus10021949 152 / 1e-47 AT5G18970 226 / 1e-76 AWPM-19-like family protein (.1)
Lus10041238 152 / 2e-47 AT5G18970 225 / 2e-76 AWPM-19-like family protein (.1)
Lus10004587 102 / 3e-28 AT5G46530 240 / 2e-82 AWPM-19-like family protein (.1)
Lus10015255 101 / 7e-28 AT5G46530 240 / 2e-82 AWPM-19-like family protein (.1)
Lus10011973 101 / 9e-28 AT5G46530 240 / 2e-82 AWPM-19-like family protein (.1)
Lus10025374 101 / 1e-27 AT5G46530 241 / 4e-83 AWPM-19-like family protein (.1)
Lus10014456 49 / 1e-07 AT1G04560 254 / 2e-87 AWPM-19-like family protein (.1)
Lus10023713 49 / 1e-07 AT1G04560 254 / 2e-87 AWPM-19-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05512 AWPM-19 AWPM-19-like family
Representative CDS sequence
>Potri.008G200300.1 pacid=42807797 polypeptide=Potri.008G200300.1.p locus=Potri.008G200300 ID=Potri.008G200300.1.v4.1 annot-version=v4.1
ATGGCTTCCGGAGCAAGCAAACCCACTGCCTTCATGCTCTTAATCCTTAATATGGGGCTGTATTTTTTCATGATAATAATCAGTTCATGGATTATAAATC
ATGGAATTGTAAGATCTCGTGAATCAGCGGCTATTTTGACAATTCCAGCTCGCATATTTCCAATATACTTCCCAATGGGAAATTTGGCAACAGGTTTCTT
CATCATTCTCTCCCTTCTTGCTGGCGTTGTGGGCTTCACCTCCTCTATTACTGGACTCTATAATCTTTTTCTCTGGAATGCTCCAAGCATACACGCAACA
TATGCGTCTTCTCTTGCATCATTGTCACTCACCCTTCTAGCCATGGGATTCGCATGCAAAGAGATCAACATAGGCTGGACAGATTCAGTCTTGCGTACTC
TAGAAGTGGTGACAATAATTGTGAGTGGAACTCAATTATTGTGCACTGTTGCTACCCATGTTTGA
AA sequence
>Potri.008G200300.1 pacid=42807797 polypeptide=Potri.008G200300.1.p locus=Potri.008G200300 ID=Potri.008G200300.1.v4.1 annot-version=v4.1
MASGASKPTAFMLLILNMGLYFFMIIISSWIINHGIVRSRESAAILTIPARIFPIYFPMGNLATGFFIILSLLAGVVGFTSSITGLYNLFLWNAPSIHAT
YASSLASLSLTLLAMGFACKEINIGWTDSVLRTLEVVTIIVSGTQLLCTVATHV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G18970 AWPM-19-like family protein (.... Potri.008G200300 0 1
AT5G41470 Nuclear transport factor 2 (NT... Potri.001G100500 1.41 0.9930
AT1G54860 Glycoprotein membrane precurso... Potri.005G034300 1.41 0.9935
AT3G20570 AtENODL9 early nodulin-like protein 9 (... Potri.011G135400 2.44 0.9930
AT5G22870 Late embryogenesis abundant (L... Potri.009G003800 3.74 0.9861
AT3G50120 Plant protein of unknown funct... Potri.001G071400 3.87 0.9891
AT1G23530 unknown protein Potri.010G041600 4.00 0.9902
AT3G20570 AtENODL9 early nodulin-like protein 9 (... Potri.001G419200 4.24 0.9873
AT5G24318 O-Glycosyl hydrolases family 1... Potri.012G017800 4.69 0.9832
AT2G25735 unknown protein Potri.003G055100 4.89 0.9696
AT3G17380 TRAF-like family protein (.1) Potri.008G005300 6.00 0.9845

Potri.008G200300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.