Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G63088 49 / 3e-10 RTFL14, DVL14 DEVIL 14, ROTUNDIFOLIA like 14 (.1) AT3G23635 44 / 5e-08 RTFL13 ROTUNDIFOLIA like 13 (.1) AT3G55515 37 / 5e-05 DVL8, RTFL7 DEVIL 8, ROTUNDIFOLIA like 7 (.1) AT4G13395 35 / 9e-05 DVL10, RTFL12 DEVIL 10, ROTUNDIFOLIA like 12 (.1) AT2G39705 35 / 0.0002 RTFL8, DVL11 DEVIL 11, ROTUNDIFOLIA like 8 (.1) AT1G68825 34 / 0.0003 DVL5, RTFL15 DEVIL 5, ROTUNDIFOLIA like 15 (.1.2) AT2G36985 34 / 0.0003 DVL16, ROT4 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) AT3G53232 34 / 0.0006 RTFL1, DVL20 DEVIL 20, ROTUNDIFOLIA like 1 (.1) AT3G25717 33 / 0.0008 RTFL16, DVL6 DEVIL 6, ROTUNDIFOLIA like 16 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G030100 [exp] 82 / 3e-23 AT3G63088 49 / 3e-10 DEVIL 14, ROTUNDIFOLIA like 14 (.1) Potri.014G138900 [exp] 67 / 3e-17 AT3G63088 56 / 7e-13 DEVIL 14, ROTUNDIFOLIA like 14 (.1) Potri.010G226250 [exp] 36 / 4e-05 AT2G36985 67 / 3e-17 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.006G125600 [exp] 36 / 5e-05 AT2G36985 75 / 3e-20 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.008G035900 [exp] 35 / 0.0001 AT2G36985 66 / 1e-16 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.010G129600 [exp] 35 / 0.0001 AT1G13245 75 / 1e-20 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Potri.010G201700 [exp] 35 / 0.0002 AT2G39705 72 / 2e-18 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.003G073900 [exp] 34 / 0.0003 AT1G53708 81 / 9e-22 ROTUNDIFOLIA like 9 (.1) Potri.001G161200 [exp] 34 / 0.0003 AT1G53708 76 / 1e-19 ROTUNDIFOLIA like 9 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028393 [exp] 35 / 0.0002 AT4G35783 60 / 5e-14 DEVIL 17, ROTUNDIFOLIA like 6 (.1) Lus10034272 [exp] 35 / 0.0003 AT1G13245 72 / 5e-19 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10041491 [exp] 34 / 0.0005 AT1G13245 66 / 1e-16 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10023399 [exp] 34 / 0.0007 AT2G39705 91 / 3e-25 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10021966 [exp] 34 / 0.0007 AT1G53708 73 / 8e-19 ROTUNDIFOLIA like 9 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08137 [poplar] [flax] DVL DVL family
Representative CDS sequence Show only first row Show all	>Potri.008G202000.1 pacid=42807882 polypeptide=Potri.008G202000.1.p locus=Potri.008G202000 ID=Potri.008G202000.1.v4.1 annot-version=v4.1 ATGGCAGGAAACTTGGCCTCAATGAGATTGCCAAAGCTGCGATCATGGCAAAGGTGTTCAAGGATGGTTCGAGAGCAGAGAACGCGTTTGTACATCATTT GGAGGTGTACAGTGATTCTCCTACGCTGGGATGAGTGA
AA sequence Show only first row Show all	>Potri.008G202000.1 pacid=42807882 polypeptide=Potri.008G202000.1.p locus=Potri.008G202000 ID=Potri.008G202000.1.v4.1 annot-version=v4.1 MAGNLASMRLPKLRSWQRCSRMVREQRTRLYIIWRCTVILLRWDE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G63088		RTFL14, DVL14	DEVIL 14, ROTUNDIFOLIA like 14...		Potri.008G202000 [exp]	0	1
AT3G63470		SCPL40	serine carboxypeptidase-like 4...		Potri.001G261201 [exp]	2.00	0.8635
AT3G07960		PIP5K6	phosphatidylinositol-4-phospha...		Potri.001G027900 [exp]	3.60	0.7934
					Potri.005G161366 [exp]	9.79	0.7944
AT1G15110		PSS1	phosphatidylserine synthase 1,...		Potri.008G126100 [exp]	15.09	0.7482
AT5G46070			Guanylate-binding family prote...		Potri.005G168402 [exp]	26.94	0.8114
AT1G29740			Leucine-rich repeat transmembr...		Potri.011G073566 [exp]	30.39	0.8221
AT1G53050			Protein kinase superfamily pro...		Potri.005G086900 [exp]	35.62	0.7263
AT1G19250		FMO1	flavin-dependent monooxygenase...		Potri.018G115800 [exp]	40.24	0.7567
					Potri.001G062301 [exp]	42.89	0.7714
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Potri.004G026200 [exp]	44.69	0.7491

Compare expression of checked genes

Potri.008G202000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.