Plant FIBer expression Database

Potri.008G202133 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG01050 55 / 3e-10 ATCG01050.1, NDHD NADH-Ubiquinone/plastoquinone (complex I) protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.008G202133.1 pacid=42806704 polypeptide=Potri.008G202133.1.p locus=Potri.008G202133 ID=Potri.008G202133.1.v4.1 annot-version=v4.1
ATGATTTTGGAGGCTCAAAAACCAAAAGACATCCTGTGGGCTTGTGGCCCGGAATTGGTAGTATTTTTTGGAATAATTACCGTAAGAAAATATTTTTTAA
TACCAAAAATATTAATTACTTTTATGTTTTATGGATATAAACTGTTTAATACCACAAATTTTTATTTTTTTTATTTTGGACCACGAGAATTATTTGTTTT
GACTGCTATCATTTTGCCTGTAATTAGTATTGGTATTTATCCGAATTTCGTTTTCTCATTATAA
AA sequence
>Potri.008G202133.1 pacid=42806704 polypeptide=Potri.008G202133.1.p locus=Potri.008G202133 ID=Potri.008G202133.1.v4.1 annot-version=v4.1
MILEAQKPKDILWACGPELVVFFGIITVRKYFLIPKILITFMFYGYKLFNTTNFYFFYFGPRELFVLTAIILPVISIGIYPNFVFSL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG01050 ATCG01050.1, ND... NADH-Ubiquinone/plastoquinone ... Potri.008G202133
[exp]
0 1
ATCG00300 ATCG00300.1, YC... YCF9 (.1) Potri.013G142548
[exp]
5.29 0.8650
ATCG00640 ATCG00640.1, RP... ribosomal protein L33 (.1) Potri.003G067400
[exp]
6.00 0.8803
ATCG00070 ATCG00070.1, PS... photosystem II reaction center... Potri.013G138100
[exp]
9.48 0.8310
ATCG00270 ATCG00270.1, PS... photosystem II reaction center... Potri.013G142201
[exp]
10.90 0.8418
ATCG01060 ATCG01060.1, PS... iron-sulfur cluster binding;el... Potri.019G014344
[exp]
13.74 0.8317
ATCG00630 ATCG00630.1, PS... PSAJ (.1) Potri.003G067501
[exp]
13.85 0.8361
ATCG00720 ATCG00720.1, PE... photosynthetic electron transf... Potri.011G113784
[exp]
23.64 0.8138
ATCG00720 ATCG00720.1, PE... photosynthetic electron transf... Potri.011G074700
[exp]
26.55 0.8024
AT1G48170 unknown protein Potri.008G099700
[exp]
27.20 0.7067
ATCG00080 ATCG00080.1, PS... photosystem II reaction center... Potri.013G138690
[exp]
29.73 0.7744

Potri.008G202133 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.