Potri.008G202600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G19070 338 / 2e-117 SNARE associated Golgi protein family (.1)
AT1G03260 314 / 3e-108 SNARE associated Golgi protein family (.1)
AT1G22850 79 / 1e-16 SNARE associated Golgi protein family (.1)
AT2G02370 58 / 2e-09 SNARE associated Golgi protein family (.1.2)
AT4G09580 48 / 3e-06 SNARE associated Golgi protein family (.1)
AT1G71940 45 / 3e-05 SNARE associated Golgi protein family (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G030800 424 / 1e-151 AT5G19070 321 / 7e-111 SNARE associated Golgi protein family (.1)
Potri.013G099600 83 / 4e-18 AT1G22850 305 / 6e-102 SNARE associated Golgi protein family (.1)
Potri.019G071900 81 / 1e-17 AT1G22850 330 / 8e-113 SNARE associated Golgi protein family (.1)
Potri.003G151800 50 / 5e-07 AT2G02370 377 / 2e-131 SNARE associated Golgi protein family (.1.2)
Potri.001G078700 50 / 8e-07 AT2G02370 390 / 2e-136 SNARE associated Golgi protein family (.1.2)
Potri.001G140200 45 / 3e-05 AT4G17790 379 / 2e-134 SNARE associated Golgi protein family (.1)
Potri.013G113000 43 / 0.0001 AT4G09580 454 / 5e-163 SNARE associated Golgi protein family (.1)
Potri.003G094000 43 / 0.0001 AT4G17790 378 / 8e-134 SNARE associated Golgi protein family (.1)
Potri.019G083500 42 / 0.0002 AT1G71940 460 / 1e-165 SNARE associated Golgi protein family (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034028 371 / 4e-130 AT5G19070 363 / 3e-127 SNARE associated Golgi protein family (.1)
Lus10004421 369 / 2e-129 AT5G19070 361 / 2e-126 SNARE associated Golgi protein family (.1)
Lus10021942 322 / 2e-111 AT5G19070 343 / 9e-120 SNARE associated Golgi protein family (.1)
Lus10028016 272 / 2e-91 AT1G03260 328 / 2e-113 SNARE associated Golgi protein family (.1)
Lus10012371 244 / 8e-81 AT1G03260 274 / 1e-92 SNARE associated Golgi protein family (.1)
Lus10041229 151 / 4e-41 AT3G23590 1595 / 0.0 REF4-related 1 (.1)
Lus10006162 76 / 2e-15 AT1G22850 394 / 2e-137 SNARE associated Golgi protein family (.1)
Lus10041062 74 / 6e-15 AT1G22850 377 / 2e-131 SNARE associated Golgi protein family (.1)
Lus10012163 46 / 1e-05 AT2G02370 401 / 4e-141 SNARE associated Golgi protein family (.1.2)
Lus10008915 44 / 7e-05 AT1G12450 338 / 5e-117 SNARE associated Golgi protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09335 SNARE_assoc SNARE associated Golgi protein
Representative CDS sequence
>Potri.008G202600.3 pacid=42807863 polypeptide=Potri.008G202600.3.p locus=Potri.008G202600 ID=Potri.008G202600.3.v4.1 annot-version=v4.1
ATGGCTTCTTTTTCATGGGCTTCTCTTCTCAGGATCACCATCTTTCTTCTCCTTGTTGCCGCTGCTGTTTTTGCCTTCTTCACTCTCCCTGTTGAAAAGA
TTTTGAAGGATTTCTTGTTATGGGTTGAGCAGGATCTCGGGCCTTGGGGTCCCCTCGTACTGGCTATTGCATATATTCCTCTAACAATCTTGGCTGTTCC
AGCTTCAGTGCTTACTCTTGGTGGTGGATATCTTTTCGGGTTGCCCGTGGGCTTTGTTGCCGATTCTATCGGCGCCACAGTTGGTGCTGGGGCAGCATTT
CTTCTAGGAAGAACAATTGGTAGATCTTTCGTTGTCTCCAAGTTGAAGGATTACCCAAAGTTTAGTTCAGTTGCAATTGCTATTCAGAAGTCTGGCTTCA
AGATTGTTCTGCTGCTTCGACTTGTTCCTTTACTGCCTTTCAACATGCTGAATTACCTGCTGTCAGTCACTCCTGTTCCAATAGGGGAATACATGCTGGC
TTCCTGGATAGGAATGATGCCAATAACCCTTGCTTTAGTGTACATTGGAACGACACTCAAGGATCTTTCTGATGTGACTCATGGGTGGAGTGAGTTTTCA
ACTACTCGTTGGGTTCTTATTGTATTGGGCCTTGTTGTATCTGTGGTTCTTATGTTTTGTGTTACTAAAGTCGCCAAGTCTGCTTTGGATAAAGCTTTGG
CCGAAAACGAGGATCTAGATGTCATTTTGGCATCACCTCAATTACCCATTGTGGCAGATACTTCTGTTAATCTGAACCAGCCTCTCATTATCAAGATAGA
CCCGTCTGAAGATAACCATGAACAATGA
AA sequence
>Potri.008G202600.3 pacid=42807863 polypeptide=Potri.008G202600.3.p locus=Potri.008G202600 ID=Potri.008G202600.3.v4.1 annot-version=v4.1
MASFSWASLLRITIFLLLVAAAVFAFFTLPVEKILKDFLLWVEQDLGPWGPLVLAIAYIPLTILAVPASVLTLGGGYLFGLPVGFVADSIGATVGAGAAF
LLGRTIGRSFVVSKLKDYPKFSSVAIAIQKSGFKIVLLLRLVPLLPFNMLNYLLSVTPVPIGEYMLASWIGMMPITLALVYIGTTLKDLSDVTHGWSEFS
TTRWVLIVLGLVVSVVLMFCVTKVAKSALDKALAENEDLDVILASPQLPIVADTSVNLNQPLIIKIDPSEDNHEQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G19070 SNARE associated Golgi protein... Potri.008G202600 0 1
AT1G55300 TAF7 TBP-associated factor 7 (.1.2) Potri.001G006300 1.41 0.8517
AT2G41430 LSR1, CID1, ERD... CTC-Interacting Domain 1, dehy... Potri.003G202500 1.41 0.8530
AT4G38690 PLC-like phosphodiesterases su... Potri.004G172000 6.40 0.7260
AT5G61580 PFK4 phosphofructokinase 4 (.1.2) Potri.001G079501 7.48 0.8057
AT3G55380 UBC14 ubiquitin-conjugating enzyme 1... Potri.008G053900 7.48 0.8173 Pt-UBC7.1
AT1G19310 RING/U-box superfamily protein... Potri.002G133000 8.36 0.8172
AT3G05010 Protein of unknown function, t... Potri.005G044700 11.83 0.8063
AT5G53200 MYB TRY TRIPTYCHON, Homeodomain-like s... Potri.002G168900 12.84 0.8010
AT3G59390 unknown protein Potri.019G051300 12.96 0.7979
AT4G14600 Target SNARE coiled-coil domai... Potri.005G159600 14.14 0.8023

Potri.008G202600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.