Potri.008G204100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G06070 97 / 9e-27 unknown protein
AT5G19190 94 / 8e-26 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034044 137 / 4e-43 AT3G06070 92 / 7e-25 unknown protein
Lus10010508 127 / 2e-39 AT3G06070 94 / 1e-25 unknown protein
Lus10019824 41 / 4e-05 ND /
PFAM info
Representative CDS sequence
>Potri.008G204100.1 pacid=42805947 polypeptide=Potri.008G204100.1.p locus=Potri.008G204100 ID=Potri.008G204100.1.v4.1 annot-version=v4.1
ATGGAAATGGCTATGGAATTAGAAGATGATTTGTTCTTTGCAGACTTAAGCAAGCAAATATCTCTTCTAATAATGGATGACGATGATGAGGACCCTTCAG
TTTCTTTTCAGGCTTTCTCCAGAGGCAACTATCCAAGTGCACCATCTCATTCCATGTATGAGCAAAACTGCAGAAGGGAAAGCTGCAAGGGAACAGGAGT
TTTTATCCCCAAGTCTTCACAGCCAAGAAGGAAACACAGACAAGGAAGATACAGCCAAAAGTCTAATAACAGGCAGCATGATAACACAAGAGTGGTTTCT
CAAGTATCATACAGCAATGCTTTCAAATCCAAGAAAAGCTAA
AA sequence
>Potri.008G204100.1 pacid=42805947 polypeptide=Potri.008G204100.1.p locus=Potri.008G204100 ID=Potri.008G204100.1.v4.1 annot-version=v4.1
MEMAMELEDDLFFADLSKQISLLIMDDDDEDPSVSFQAFSRGNYPSAPSHSMYEQNCRRESCKGTGVFIPKSSQPRRKHRQGRYSQKSNNRQHDNTRVVS
QVSYSNAFKSKKS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G06070 unknown protein Potri.008G204100 0 1
AT5G48270 Plant protein of unknown funct... Potri.010G047700 3.00 0.9212
AT2G03090 ATHEXPALPHA1.3,... EXPANSIN 15, expansin A15 (.1) Potri.013G060800 3.87 0.8963 Pt-EXP2.5,PtrEXPA11
AT5G44680 DNA glycosylase superfamily pr... Potri.003G156500 8.48 0.8995
AT5G46880 HD HDG5, HB-7 HOMEODOMAIN GLABROUS 5, homeob... Potri.003G096000 14.14 0.8942
Potri.002G138100 17.23 0.8664
AT4G01470 ATTIP1.3, GAMMA... tonoplast intrinsic protein 1;... Potri.004G216500 19.89 0.8746
Potri.002G252400 20.49 0.8721
AT5G49800 Polyketide cyclase/dehydrase a... Potri.004G231000 21.74 0.8133
AT3G60120 BGLU27 beta glucosidase 27 (.1) Potri.005G059500 21.90 0.8678
AT5G48960 HAD-superfamily hydrolase, sub... Potri.010G002900 22.97 0.8114

Potri.008G204100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.