Potri.008G206100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.008G206100.3 pacid=42808730 polypeptide=Potri.008G206100.3.p locus=Potri.008G206100 ID=Potri.008G206100.3.v4.1 annot-version=v4.1
ATGTCACTTGTTGATTTCTTTTTTTGTCAATTTTCACACACGTTTCCTTATTTATATATTTCTCTTATTTGTTTTTTTGTAGTTGTTGCCAAAAAAATAA
ATATAGAATCCAACCCGTACCAGGAGTCTATAAATTCTAGGAAGCCAGTCCTCTCTTACAAGGAGAAAAACAACGATCCTATTGATACCGCTCCAATTTC
TCTTCGAACACGAGGCGTTTCCGCACCTAGGGATGGAATTATCAAAGGGACTCCTGGAACTCTTTCGCCTAAGGTTACTTCATTACCTCCAACAACAGAA
GTGATCCATCTTGAAAAAGATGCTCTTTTAGAGGCTGTTATTGCTGCTTCTTTAAGAACTCTAACCTTCCCAGCTTTCAGAATTAAGCTTGTGGATCAAG
TACAAAAAGTGACTCTTGTTCCAATGAAAGTTTAA
AA sequence
>Potri.008G206100.3 pacid=42808730 polypeptide=Potri.008G206100.3.p locus=Potri.008G206100 ID=Potri.008G206100.3.v4.1 annot-version=v4.1
MSLVDFFFCQFSHTFPYLYISLICFFVVVAKKINIESNPYQESINSRKPVLSYKEKNNDPIDTAPISLRTRGVSAPRDGIIKGTPGTLSPKVTSLPPTTE
VIHLEKDALLEAVIAASLRTLTFPAFRIKLVDQVQKVTLVPMKV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.008G206100 0 1
AT1G04270 RPS15 cytosolic ribosomal protein S1... Potri.005G055401 3.87 0.8577
Potri.014G022050 5.47 0.8239
Potri.004G046401 6.32 0.8375
Potri.002G047750 9.16 0.8790
Potri.016G114550 13.03 0.7189
AT2G06530 VPS2.1 SNF7 family protein (.1) Potri.006G144300 13.56 0.7737
Potri.001G382300 15.16 0.8107
Potri.002G111832 16.09 0.8455
Potri.009G014750 16.24 0.8236
AT3G24060 Plant self-incompatibility pro... Potri.001G053300 18.97 0.7130

Potri.008G206100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.