Potri.008G210650 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G210450 150 / 1e-49 ND /
Potri.008G218433 150 / 1e-49 ND /
Potri.010G008053 107 / 1e-32 ND /
Potri.010G008009 107 / 2e-32 ND /
Potri.010G007976 105 / 7e-32 ND /
Potri.010G007921 103 / 5e-31 ND /
Potri.010G010416 101 / 3e-30 ND /
Potri.010G007998 101 / 4e-30 ND /
Potri.010G008031 101 / 4e-30 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.008G210650.1 pacid=42806177 polypeptide=Potri.008G210650.1.p locus=Potri.008G210650 ID=Potri.008G210650.1.v4.1 annot-version=v4.1
ATGGCACGCCAGGCAGATCGCCTTATTAAGATTGGGTTGGAGGGCTTTGCGGCCATAGATGAGAGCTTCGGCCGGGCCAAGAGGCCACCAGTTCTGAAGA
TCCCCAATCCTCATCCGCCAAGCCAAATTCCTGTAACAAAAGTTATCGACAGCGACGAGGCAGCTCAACTCTATGGTGGGAGGGGTTATATTAATTATCG
CAAAGGAAAACCAGTTCCCTTTTAA
AA sequence
>Potri.008G210650.1 pacid=42806177 polypeptide=Potri.008G210650.1.p locus=Potri.008G210650 ID=Potri.008G210650.1.v4.1 annot-version=v4.1
MARQADRLIKIGLEGFAAIDESFGRAKRPPVLKIPNPHPPSQIPVTKVIDSDEAAQLYGGRGYINYRKGKPVPF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.008G210650 0 1
Potri.008G218433 3.46 0.9840
AT5G02750 SGR9 SHOOT GRAVITROPISM 9, RING/U-b... Potri.006G216200 3.87 0.9764
Potri.008G210450 4.00 0.9836
AT1G52220 unknown protein Potri.003G052200 16.30 0.9504
AT3G08740 elongation factor P (EF-P) fam... Potri.016G136600 18.70 0.9631
AT2G01590 CRR3 chlororespiratory reduction 3 ... Potri.010G110100 19.33 0.9552
AT5G65840 Thioredoxin superfamily protei... Potri.014G012100 20.59 0.9614
AT1G65260 VIPP1, PTAC4 VESICLE-INDUCING PROTEIN IN PL... Potri.016G099400 28.56 0.9485 IM30.2
AT3G20680 Domain of unknown function (DU... Potri.011G132500 28.63 0.9556
AT3G63310 BIL4 BRZ-INSENSITIVE-LONG HYPOCOTYL... Potri.008G157100 32.86 0.9305

Potri.008G210650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.