Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G24020 49 / 7e-08 MLP423 MLP-like protein 423 (.1.2) AT5G45860 46 / 1e-06 RCAR5, PYL11 regulatory components of ABA receptor 5, PYR1-like 11 (.1) AT5G28010 40 / 0.0001 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT5G45870 39 / 0.0004 RCAR6, PYL12 regulatory components of ABA receptor 6, PYR1-like 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G000600 [exp] 167 / 7e-54 AT1G24020 67 / 1e-14 MLP-like protein 423 (.1.2) Potri.010G000400 [exp] 166 / 2e-53 AT1G24020 66 / 4e-14 MLP-like protein 423 (.1.2) Potri.010G000200 [exp] 164 / 2e-52 AT1G24020 65 / 1e-13 MLP-like protein 423 (.1.2) Potri.008G212300 [exp] 141 / 2e-43 AT1G24020 47 / 5e-07 MLP-like protein 423 (.1.2) Potri.008G212700 [exp] 137 / 9e-42 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2) Potri.008G213446 [exp] 137 / 9e-42 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2) Potri.008G213669 [exp] 137 / 9e-42 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2) Potri.011G026100 [exp] 136 / 2e-41 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2) Potri.004G021100 [exp] 135 / 3e-41 AT1G24020 53 / 4e-09 MLP-like protein 423 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016839 [exp] 173 / 8e-56 ND / Lus10016840 [exp] 172 / 2e-55 AT1G24020 58 / 5e-11 MLP-like protein 423 (.1.2) Lus10037715 [exp] 167 / 2e-53 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2) Lus10003187 [exp] 136 / 3e-41 AT5G45860 46 / 1e-06 regulatory components of ABA receptor 5, PYR1-like 11 (.1) Lus10014508 [exp] 116 / 1e-33 ND / Lus10032178 [exp] 113 / 2e-32 ND / Lus10015339 [exp] 110 / 4e-31 ND 41 / 6e-05 Lus10039454 [exp] 107 / 4e-30 AT1G24020 43 / 1e-05 MLP-like protein 423 (.1.2) Lus10005608 [exp] 100 / 2e-27 ND / Lus10030646 [exp] 55 / 9e-10 AT1G24020 189 / 3e-62 MLP-like protein 423 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [poplar] [flax] Bet_v_1_like PF00407 [poplar] [flax] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Potri.008G212100.1 pacid=42807170 polypeptide=Potri.008G212100.1.p locus=Potri.008G212100 ID=Potri.008G212100.1.v4.1 annot-version=v4.1 ATGGGTGTCGCTAGCTACACACAAGAATTTACATGCCCAATTTCCCCAGCACGCATGTTCAAGGCCTTAATCTTAGACTCAAACAATTTGATCCCAAAAC TCTTGCCGCAAATCGTAAAAAGTGTTGATTTAATCCATGGAGATGGAGGAGCTGGAAGCATAGAGCAAGTCAACTTCACTGAAGGTACTGATATCAAATA CGTGAAGCATCGAATTGATGAGCTAGACAGAGTCAATCTCGTTTGCAAGTACACTATGATTGAAGGGGATTCACTTGGGGAGAAGCTTGAATCTATTGCT TATGAGGTCAGGTTTGAGGTAGGGAGTGATGGAGGTTGCGATTGTAAGATGACAAGCAGCTATTTAATGCTTGGAGATTTTACTCTCAAAGAGGAAGAAA TCAAGGCTGGTCAAGACAAAGCTAGGGGAATATACAAAGTCGTGGAAGCCTACCTCTTGGAGAACCCTCATGTCTATGCTTAG
AA sequence Show only first row Show all	>Potri.008G212100.1 pacid=42807170 polypeptide=Potri.008G212100.1.p locus=Potri.008G212100 ID=Potri.008G212100.1.v4.1 annot-version=v4.1 MGVASYTQEFTCPISPARMFKALILDSNNLIPKLLPQIVKSVDLIHGDGGAGSIEQVNFTEGTDIKYVKHRIDELDRVNLVCKYTMIEGDSLGEKLESIA YEVRFEVGSDGGCDCKMTSSYLMLGDFTLKEEEIKAGQDKARGIYKVVEAYLLENPHVYA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.008G212100 [exp]	0	1
AT4G13420		HAK5, ATHAK5	high affinity K+ transporter 5...		Potri.014G132500 [exp]	2.00	0.9784
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.008G213100 [exp]	3.00	0.9806
AT1G51920			unknown protein		Potri.003G061000 [exp]	4.47	0.9698
AT2G26560		PLP2, PLAIIA, P...	PATATIN-LIKE PROTEIN 2, phosph...		Potri.017G133951 [exp]	13.26	0.9706
					Potri.008G163200 [exp]	16.09	0.9627
AT1G20560		AAE1	acyl activating enzyme 1 (.1.2...		Potri.007G059401 [exp]	18.33	0.9779
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Potri.003G099000 [exp]	23.97	0.9730
AT4G27270			Quinone reductase family prote...		Potri.011G033100 [exp]	29.34	0.9202	Pt-P78RF.1
AT1G78780			pathogenesis-related family pr...		Potri.005G188400 [exp]	30.70	0.9646	Pt-PR.3
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Potri.001G222800 [exp]	31.84	0.9720

Compare expression of checked genes

Potri.008G212100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.