Potri.008G212500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45860 40 / 0.0002 RCAR5, PYL11 regulatory components of ABA receptor 5, PYR1-like 11 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G212400 314 / 7e-112 ND /
Potri.011G026100 260 / 2e-90 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2)
Potri.011G026200 259 / 2e-90 AT1G24020 52 / 1e-08 MLP-like protein 423 (.1.2)
Potri.011G026032 258 / 1e-89 AT1G24020 53 / 4e-09 MLP-like protein 423 (.1.2)
Potri.011G025966 258 / 1e-89 AT1G24020 55 / 7e-10 MLP-like protein 423 (.1.2)
Potri.011G025900 258 / 1e-89 AT1G24020 55 / 7e-10 MLP-like protein 423 (.1.2)
Potri.014G152800 256 / 4e-89 AT1G24020 54 / 1e-09 MLP-like protein 423 (.1.2)
Potri.004G021100 253 / 1e-87 AT1G24020 53 / 4e-09 MLP-like protein 423 (.1.2)
Potri.008G213100 244 / 9e-84 AT1G24020 52 / 1e-08 MLP-like protein 423 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003187 122 / 5e-36 AT5G45860 46 / 1e-06 regulatory components of ABA receptor 5, PYR1-like 11 (.1)
Lus10016840 118 / 2e-34 AT1G24020 58 / 5e-11 MLP-like protein 423 (.1.2)
Lus10037715 112 / 8e-32 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2)
Lus10014508 99 / 1e-26 ND /
Lus10032178 97 / 5e-26 ND /
Lus10016839 78 / 1e-18 ND /
Lus10005608 76 / 6e-18 ND /
Lus10037393 52 / 8e-09 AT2G26040 39 / 5e-04 regulatory components of ABA receptor 14, PYR1-like 2 (.1)
Lus10041320 45 / 4e-06 ND 37 / 0.003
Lus10007530 43 / 2e-05 AT2G38310 198 / 1e-65 regulatory components of ABA receptor 10, PYR1-like 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Potri.008G212500.2 pacid=42805791 polypeptide=Potri.008G212500.2.p locus=Potri.008G212500 ID=Potri.008G212500.2.v4.1 annot-version=v4.1
ATGGGTCTCATCACTTTTGAAAATGAGTTTTCTGTCGCTGTCCCTCCTGCCAAGCTCTTCAAGGTCTATTGCCTTGAGACTGATACTCTTATACCTAAAA
TTCTACCACAATCAATTAAAAGCTCTGAGATAATTGAAGGAAATGGAGGGCCAGGAACAATAAGGAAGGTCACTTTTGTTGAAGGCAAAGGACTCACCTA
CGTGAAGCAGAAGATTGAAACAATTGATGAAGAGAATTTCGCATACAGCTTCAGTTTGATTGAATCAAACGTTTGGATGGAGGGAGTTGAGAAAGTCATT
TTCGAACATAAGTTTGTGCCCACTCCTGAGGGAGGATCCATCTGCAAAAGAACAAGCAAGTACTATATAAAGGATGGTGCTGAGATCAAGGAGGATCAAA
TCAAGAAGGATGGCAGGAAGACCGAAGGACTGTTCAAGGCTGTCGAAGCTTACTTCTTGGCAAATCCTGATGCGTGA
AA sequence
>Potri.008G212500.2 pacid=42805791 polypeptide=Potri.008G212500.2.p locus=Potri.008G212500 ID=Potri.008G212500.2.v4.1 annot-version=v4.1
MGLITFENEFSVAVPPAKLFKVYCLETDTLIPKILPQSIKSSEIIEGNGGPGTIRKVTFVEGKGLTYVKQKIETIDEENFAYSFSLIESNVWMEGVEKVI
FEHKFVPTPEGGSICKRTSKYYIKDGAEIKEDQIKKDGRKTEGLFKAVEAYFLANPDA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.008G212500 0 1
Potri.008G212400 1.00 0.9949
AT5G42830 HXXXD-type acyl-transferase fa... Potri.014G025500 2.23 0.9608
Potri.019G016114 2.44 0.9722
AT2G32210 unknown protein Potri.001G439800 2.82 0.9730
AT1G28380 NSL1 necrotic spotted lesions 1, MA... Potri.011G057100 2.82 0.9504
AT2G45040 Matrixin family protein (.1) Potri.001G157500 4.58 0.9546 Pt-MMP.15
AT2G31335 unknown protein Potri.019G012700 4.69 0.9330
Potri.015G088800 6.92 0.9381
AT1G35710 Protein kinase family protein ... Potri.014G195200 8.12 0.9458
AT4G19950 unknown protein Potri.005G186200 9.16 0.9556 ORF.5

Potri.008G212500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.