Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G24020 47 / 4e-08 MLP423 MLP-like protein 423 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G213669 [exp] 159 / 9e-52 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2) Potri.008G213446 [exp] 159 / 9e-52 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2) Potri.008G212700 [exp] 159 / 9e-52 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2) Potri.008G213223 [exp] 153 / 3e-50 AT1G24020 64 / 6e-14 MLP-like protein 423 (.1.2) Potri.010G000600 [exp] 86 / 4e-23 AT1G24020 67 / 1e-14 MLP-like protein 423 (.1.2) Potri.010G000400 [exp] 79 / 5e-20 AT1G24020 66 / 4e-14 MLP-like protein 423 (.1.2) Potri.011G025966 [exp] 77 / 1e-19 AT1G24020 55 / 7e-10 MLP-like protein 423 (.1.2) Potri.011G025900 [exp] 77 / 1e-19 AT1G24020 55 / 7e-10 MLP-like protein 423 (.1.2) Potri.011G026100 [exp] 77 / 1e-19 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003187 [exp] 75 / 1e-18 AT5G45860 46 / 1e-06 regulatory components of ABA receptor 5, PYR1-like 11 (.1) Lus10016840 [exp] 73 / 7e-18 AT1G24020 58 / 5e-11 MLP-like protein 423 (.1.2) Lus10037715 [exp] 72 / 3e-17 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2) Lus10016839 [exp] 52 / 2e-09 ND / Lus10014508 [exp] 47 / 5e-08 ND / Lus10032178 [exp] 46 / 1e-07 ND / Lus10010699 [exp] 43 / 8e-07 AT1G24020 56 / 7e-11 MLP-like protein 423 (.1.2) Lus10010698 [exp] 43 / 4e-06 AT1G24020 94 / 2e-22 MLP-like protein 423 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [poplar] [flax] Bet_v_1_like PF00407 [poplar] [flax] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Potri.008G212923.1 pacid=42807972 polypeptide=Potri.008G212923.1.p locus=Potri.008G212923 ID=Potri.008G212923.1.v4.1 annot-version=v4.1 ATGGGAGTTTTCACTTACGAATCAGAGGCTTCTACTGTGATGCCACCAGCCAGGCTGTTCAAGGCCCTTTTCGTTGATGCTGCTGAAGTCATGCCCAAAG CCCTGCCACAGGCTATTAAAAGCATTGTCACTCTTGAAGGAGATGGAGGCCCTGGAACCATCAAGCAAACTTATTTTGGCGATGGTAGCCTATCTTTCAA GGAGAGGACTGATGCTATTGACAATGAGAATTTATCATAG
AA sequence Show only first row Show all	>Potri.008G212923.1 pacid=42807972 polypeptide=Potri.008G212923.1.p locus=Potri.008G212923 ID=Potri.008G212923.1.v4.1 annot-version=v4.1 MGVFTYESEASTVMPPARLFKALFVDAAEVMPKALPQAIKSIVTLEGDGGPGTIKQTYFGDGSLSFKERTDAIDNENLS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.008G212923 [exp]	0	1
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.008G213446 [exp]	1.73	0.9998
					Potri.014G081900 [exp]	2.00	0.9997
AT1G02335		GL22	germin-like protein subfamily ...		Potri.010G240700 [exp]	2.23	0.9992	Pt-GER2.16
					Potri.001G307100 [exp]	3.87	0.9996
					Potri.003G126400 [exp]	5.91	0.9990
AT5G23210		SCPL34	serine carboxypeptidase-like 3...		Potri.005G091800 [exp]	6.32	0.9986
AT1G11310		PMR2, ATMLO2, M...	POWDERY MILDEW RESISTANT 2, MI...		Potri.005G254300 [exp]	6.92	0.9977
AT5G45340		CYP707A3	"cytochrome P450, family 707, ...		Potri.002G069600 [exp]	8.24	0.9950
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.008G212700 [exp]	8.48	0.9988	Pt-BETV1.5
AT5G45890		SAG12	senescence-associated gene 12 ...		Potri.013G126100 [exp]	8.48	0.9987

Compare expression of checked genes

Potri.008G212923 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.