Potri.008G213223 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G24020 65 / 4e-14 MLP423 MLP-like protein 423 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G213669 234 / 4e-81 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2)
Potri.008G213446 234 / 4e-81 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2)
Potri.008G212700 234 / 4e-81 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2)
Potri.008G212923 153 / 4e-50 AT1G24020 47 / 5e-08 MLP-like protein 423 (.1.2)
Potri.010G000600 135 / 9e-42 AT1G24020 67 / 1e-14 MLP-like protein 423 (.1.2)
Potri.011G025900 110 / 4e-32 AT1G24020 55 / 7e-10 MLP-like protein 423 (.1.2)
Potri.011G025966 110 / 4e-32 AT1G24020 55 / 7e-10 MLP-like protein 423 (.1.2)
Potri.011G026032 110 / 4e-32 AT1G24020 53 / 4e-09 MLP-like protein 423 (.1.2)
Potri.011G026100 110 / 4e-32 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016840 106 / 3e-30 AT1G24020 58 / 5e-11 MLP-like protein 423 (.1.2)
Lus10003187 102 / 1e-28 AT5G45860 46 / 1e-06 regulatory components of ABA receptor 5, PYR1-like 11 (.1)
Lus10037715 97 / 2e-26 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2)
Lus10014508 71 / 2e-16 ND /
Lus10016839 69 / 1e-15 ND /
Lus10039454 69 / 1e-15 AT1G24020 43 / 1e-05 MLP-like protein 423 (.1.2)
Lus10015339 69 / 1e-15 ND 41 / 6e-05
Lus10032178 67 / 5e-15 ND /
Lus10005608 54 / 6e-10 ND /
Lus10010698 52 / 7e-09 AT1G24020 94 / 2e-22 MLP-like protein 423 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Potri.008G213223.1 pacid=42806728 polypeptide=Potri.008G213223.1.p locus=Potri.008G213223 ID=Potri.008G213223.1.v4.1 annot-version=v4.1
ATGGGAGTTTTCACTTACGAATCAGAGGCTTCTACTGTGATCCCACCAGCCAGGCTGTTCAAGGCCCTTTTCGTTGATGCTGCTGAAGTCATGCCCAAAG
CCCTGCCACAGGCTATTAAAAGCATTGCCATTCTTGAAGGAGATGGAGGGCCTGGAACCCTCAAGCAAACCTATTTTGGCGATGGTAGCCTATCTTTCAA
GGAGAGGACTGATGCTATTGACAAGGAGAATTTATCATATGCGTACACTGTGTTCGAAGGTGCTGTCTTGGCAAACACATATGAAAAAATCTTTAACGAA
TCTATGATTGAAGCCTCCCCCGACGGAGGATCGGTGTGCAAGACCAGCACCACATACTAA
AA sequence
>Potri.008G213223.1 pacid=42806728 polypeptide=Potri.008G213223.1.p locus=Potri.008G213223 ID=Potri.008G213223.1.v4.1 annot-version=v4.1
MGVFTYESEASTVIPPARLFKALFVDAAEVMPKALPQAIKSIAILEGDGGPGTLKQTYFGDGSLSFKERTDAIDKENLSYAYTVFEGAVLANTYEKIFNE
SMIEASPDGGSVCKTSTTY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.008G213223 0 1
AT4G18950 Integrin-linked protein kinase... Potri.017G123100 1.41 0.9982
Potri.014G082000 2.44 0.9979
AT4G28780 GDSL-like Lipase/Acylhydrolase... Potri.004G180400 3.87 0.9977
AT3G02100 UDP-Glycosyltransferase superf... Potri.017G091500 5.00 0.9972
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.010G000400 6.00 0.9975 MALD1.1
AT5G48450 SKS3 SKU5 similar 3 (.1) Potri.008G032100 8.12 0.9971
AT1G54630 ACP3 acyl carrier protein 3 (.1.2) Potri.006G217800 8.36 0.9969
AT5G59190 subtilase family protein (.1) Potri.003G120101 8.94 0.9838
AT5G39160 RmlC-like cupins superfamily p... Potri.001G465100 11.22 0.9923 GER2.31
Potri.005G224300 13.26 0.9950

Potri.008G213223 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.