Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1) AT4G15680 156 / 4e-51 Thioredoxin superfamily protein (.1) AT4G15690 155 / 9e-51 Thioredoxin superfamily protein (.1) AT4G15670 155 / 1e-50 Thioredoxin superfamily protein (.1) AT4G15700 153 / 4e-50 Thioredoxin superfamily protein (.1) AT4G15660 150 / 6e-49 Thioredoxin superfamily protein (.1) AT1G03020 132 / 8e-42 Thioredoxin superfamily protein (.1) AT3G62930 128 / 6e-40 Thioredoxin superfamily protein (.1) AT3G21460 125 / 5e-39 Glutaredoxin family protein (.1) AT3G62950 124 / 1e-38 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G214800 [exp] 206 / 8e-71 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1) Potri.010G021800 [exp] 188 / 9e-64 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.008G214500 [exp] 135 / 8e-43 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1) Potri.002G208400 [exp] 127 / 2e-39 AT2G30540 160 / 8e-53 Thioredoxin superfamily protein (.1) Potri.014G134000 [exp] 125 / 1e-38 AT3G62930 158 / 8e-52 Thioredoxin superfamily protein (.1) Potri.002G208500 [exp] 124 / 2e-38 AT3G62950 171 / 5e-57 Thioredoxin superfamily protein (.1) Potri.014G134200 [exp] 122 / 7e-38 AT3G62950 169 / 4e-56 Thioredoxin superfamily protein (.1) Potri.001G325800 [exp] 122 / 3e-37 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1) Potri.002G208700 [exp] 118 / 4e-36 AT3G62930 157 / 1e-51 Thioredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002887 [exp] 156 / 4e-51 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1) Lus10033965 [exp] 156 / 6e-51 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1) Lus10012815 [exp] 131 / 5e-41 AT3G21460 171 / 3e-57 Glutaredoxin family protein (.1) Lus10029441 [exp] 118 / 7e-36 AT3G62930 145 / 1e-46 Thioredoxin superfamily protein (.1) Lus10029440 [exp] 118 / 7e-36 AT3G62930 144 / 4e-46 Thioredoxin superfamily protein (.1) Lus10005941 [exp] 117 / 8e-36 AT3G62930 145 / 8e-47 Thioredoxin superfamily protein (.1) Lus10040898 [exp] 117 / 2e-35 AT3G62950 167 / 2e-55 Thioredoxin superfamily protein (.1) Lus10005938 [exp] 116 / 4e-35 AT3G62950 166 / 3e-55 Thioredoxin superfamily protein (.1) Lus10011333 [exp] 109 / 9e-32 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1) Lus10035183 [exp] 108 / 1e-31 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00462 [poplar] [flax] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Potri.008G214600.1 pacid=42806892 polypeptide=Potri.008G214600.1.p locus=Potri.008G214600 ID=Potri.008G214600.1.v4.1 annot-version=v4.1 ATGGAGAGGGTGACAAATTTGGCATCCGAGAGACCAGTTGTGATCTTCAGCAAGAGCAGTTGCTGTATGTGCCACACCATCAAGACTCTCTTCAATGAGT TTGGGGTGAACGTGGCTGTCCATGAGCTCGATGAGATGCCTAGAGGAAGGGAAATTGAGCAAGCACTCTCAAGGTTTGGATGCCCAACATTGCCTGCCGT GTTCATTGGTGGTGAACTTGTGGGTGGAGCCAATGAGGTGATGAGCCTTCACCTTAATCGTTCCTTAATCCCAATGCTTAAACGTGCTGGCGCGTTATGG GTTTGA
AA sequence Show only first row Show all	>Potri.008G214600.1 pacid=42806892 polypeptide=Potri.008G214600.1.p locus=Potri.008G214600 ID=Potri.008G214600.1.v4.1 annot-version=v4.1 MERVTNLASERPVVIFSKSSCCMCHTIKTLFNEFGVNVAVHELDEMPRGREIEQALSRFGCPTLPAVFIGGELVGGANEVMSLHLNRSLIPMLKRAGALW V

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G18600			Thioredoxin superfamily protei...		Potri.008G214600 [exp]	0	1
AT5G18600			Thioredoxin superfamily protei...		Potri.008G214800 [exp]	2.00	0.9740
					Potri.006G098500 [exp]	10.72	0.8469
AT1G70840		MLP31	MLP-like protein 31 (.1)		Potri.017G051100 [exp]	15.74	0.8598	Pt-MSG.2
AT1G79430	GARP	WDY, APL	WOODY, ALTERED PHLOEM DEVELOPM...		Potri.008G081800 [exp]	16.58	0.8202	APL.2
AT3G62800		DRB4	double-stranded-RNA-binding pr...		Potri.019G038184 [exp]	20.19	0.8200
AT4G26470			Calcium-binding EF-hand family...		Potri.002G126900 [exp]	24.33	0.8263
AT3G07510			unknown protein		Potri.014G176300 [exp]	28.35	0.8433
					Potri.008G014501 [exp]	29.22	0.7887
					Potri.003G138700 [exp]	30.28	0.8413
					Potri.012G085901 [exp]	31.22	0.7863

Compare expression of checked genes

Potri.008G214600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.