Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47340 65 / 1e-11 F-box and associated interaction domains-containing protein (.1) AT3G57590 65 / 1e-11 F-box and associated interaction domains-containing protein (.1) AT1G60370 62 / 3e-11 F-box and associated interaction domains-containing protein (.1) AT2G23160 62 / 6e-11 F-box family protein (.1) AT3G07870 62 / 1e-10 F-box and associated interaction domains-containing protein (.1) AT5G52610 61 / 1e-10 F-box and associated interaction domains-containing protein (.1) AT3G52320 61 / 3e-10 F-box and associated interaction domains-containing protein (.1) AT1G33530 60 / 3e-10 F-box family protein (.1) AT5G49610 59 / 6e-10 F-box family protein (.1) AT3G22700 59 / 7e-10 F-box and associated interaction domains-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G215800 [exp] 445 / 3e-157 AT3G07870 101 / 3e-23 F-box and associated interaction domains-containing protein (.1) Potri.008G215901 [exp] 440 / 2e-155 AT3G07870 103 / 3e-24 F-box and associated interaction domains-containing protein (.1) Potri.008G216223 [exp] 185 / 7e-57 AT3G07870 93 / 4e-21 F-box and associated interaction domains-containing protein (.1) Potri.011G137200 [exp] 174 / 2e-51 AT3G07870 94 / 1e-20 F-box and associated interaction domains-containing protein (.1) Potri.001G396800 [exp] 135 / 5e-37 AT3G07870 99 / 2e-22 F-box and associated interaction domains-containing protein (.1) Potri.001G129200 [exp] 100 / 3e-24 AT3G07870 110 / 8e-27 F-box and associated interaction domains-containing protein (.1) Potri.011G037312 [exp] 97 / 8e-23 AT3G07870 134 / 3e-35 F-box and associated interaction domains-containing protein (.1) Potri.011G037200 [exp] 94 / 1e-21 AT3G07870 134 / 6e-35 F-box and associated interaction domains-containing protein (.1) Potri.004G000900 [exp] 91 / 1e-20 AT4G12560 87 / 2e-18 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036105 [exp] 96 / 2e-22 AT3G07870 206 / 1e-61 F-box and associated interaction domains-containing protein (.1) Lus10038603 [exp] 70 / 2e-13 AT3G06240 110 / 2e-26 F-box family protein (.1) Lus10038606 [exp] 67 / 1e-12 AT3G07870 112 / 1e-27 F-box and associated interaction domains-containing protein (.1) Lus10012356 [exp] 64 / 1e-11 AT3G07870 126 / 7e-34 F-box and associated interaction domains-containing protein (.1) Lus10037892 [exp] 63 / 6e-11 AT3G06240 107 / 7e-26 F-box family protein (.1) Lus10013873 [exp] 62 / 8e-11 AT3G06240 104 / 2e-24 F-box family protein (.1) Lus10031020 [exp] 61 / 2e-10 AT3G10430 88 / 3e-19 F-box and associated interaction domains-containing protein (.1) Lus10037802 [exp] 60 / 6e-10 AT5G49610 497 / 1e-177 F-box family protein (.1) Lus10017086 [exp] 59 / 1e-09 AT5G49610 500 / 7e-179 F-box family protein (.1) Lus10023238 [exp] 58 / 2e-09 AT3G23880 126 / 6e-33 F-box and associated interaction domains-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [poplar] [flax] F-box PF00646 [poplar] [flax] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Potri.008G216000.2 pacid=42807389 polypeptide=Potri.008G216000.2.p locus=Potri.008G216000 ID=Potri.008G216000.2.v4.1 annot-version=v4.1 ATGGATGATAATCCAAGAAAAAGTGCATCAAGTTCTCAAATTCCTATTGTCATTGCAAGCAGTGAATGTCTAATGAATAAGCTTCCATCCTGTTTGATAA TGGACATACTATCAAGATTGCCCATCAAGACCATCTTGAATTGCCGGTGTGTTTGCAAGACTTGGCTTCACTACATCTCAGATTCTTTCTTTGCCAAACT CCATCTTGAAAGATCACCCACCAGCTTGCTAGTCAAAACCATATCCAACAATCCTGAATCAAGAAGCGTCCAGCTTGTCCAAATAACTGGAAAGCCTGTT GGTTTGCGCTTCCGTGTTGTTGAAGAAATGAAGTTTGTTCAGGAAATCAACCTACCCTATAATAATGATTTCTTGATTGAAAACTCTTGTAATGGGCTTC TTTGCATTTCTCAAACCTTCCAAGACGGCTCCCATGATGACATTTATTTGTGCAATCCAATTTTGGGGGAGTATATCTCCATTCCACTCGCTGCTGGACA AGGTACAAGGCATAAGAGTAGTTTCAGTTTGGGATACAGTGCCATTACTAAAGAATACCAAGTGTTGCACACTTTTTATTCGAAGAAAGGGCCTGATTCC CAACCTGAGGCTGAGATATACACGATTGGTACAGGGAAATGGAGAGGAAGCAAGCTGGTAGAGAAGATGGCAAGTCCTCTTCTGAAGGAGCATATAACTG CACCAGTCATGATCAACTTTCTGAGAGCATTCCTCCACAGCACATTACAAATGGTGACCTGTCTGATAGCATCTCTGCAGAGTTTTTACCTAAGCTCTTC TGATTTTCAAGTTCTGTTGCGTGATTTTAGATGA
AA sequence Show only first row Show all	>Potri.008G216000.2 pacid=42807389 polypeptide=Potri.008G216000.2.p locus=Potri.008G216000 ID=Potri.008G216000.2.v4.1 annot-version=v4.1 MDDNPRKSASSSQIPIVIASSECLMNKLPSCLIMDILSRLPIKTILNCRCVCKTWLHYISDSFFAKLHLERSPTSLLVKTISNNPESRSVQLVQITGKPV GLRFRVVEEMKFVQEINLPYNNDFLIENSCNGLLCISQTFQDGSHDDIYLCNPILGEYISIPLAAGQGTRHKSSFSLGYSAITKEYQVLHTFYSKKGPDS QPEAEIYTIGTGKWRGSKLVEKMASPLLKEHITAPVMINFLRAFLHSTLQMVTCLIASLQSFYLSSSDFQVLLRDFR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G47340			F-box and associated interacti...		Potri.008G216000 [exp]	0	1
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Potri.018G095900 [exp]	1.41	0.9690
AT2G29150			NAD(P)-binding Rossmann-fold s...		Potri.006G089800 [exp]	5.47	0.9581
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Potri.018G070900 [exp]	5.47	0.9599
AT5G49350			Glycine-rich protein family (....		Potri.008G108400 [exp]	9.48	0.9543
AT1G51190	AP2_ERF	PLT2	PLETHORA 2, Integrase-type DNA...		Potri.003G205700 [exp]	10.19	0.9484	RAP23
AT5G22810			GDSL-like Lipase/Acylhydrolase...		Potri.009G151000 [exp]	11.48	0.9531
AT2G37050			Leucine-rich repeat protein ki...		Potri.007G004700 [exp]	12.00	0.9549
					Potri.007G114100 [exp]	12.12	0.9511
					Potri.003G020701 [exp]	16.73	0.9095
AT1G79580	NAC	ANAC033, SMB, N...	NAC (No Apical Meristem) domai...		Potri.010G176600 [exp]	17.54	0.9405

Compare expression of checked genes

Potri.008G216000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.