Potri.008G216223 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07870 94 / 3e-21 F-box and associated interaction domains-containing protein (.1)
AT4G12560 76 / 5e-15 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
AT3G21410 58 / 4e-09 F-box and associated interaction domains-containing protein (.1)
AT3G06240 56 / 1e-08 F-box family protein (.1)
AT3G22700 55 / 2e-08 F-box and associated interaction domains-containing protein (.1)
AT3G22730 54 / 5e-08 F-box and associated interaction domains-containing protein (.1)
AT3G16880 54 / 7e-08 F-box and associated interaction domains-containing protein (.1)
AT5G50220 54 / 7e-08 F-box family protein (.1)
AT1G53360 53 / 1e-07 F-box associated ubiquitination effector family protein (.1)
AT1G55070 53 / 1e-07 F-box and associated interaction domains-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G215901 557 / 0 AT3G07870 103 / 3e-24 F-box and associated interaction domains-containing protein (.1)
Potri.008G215800 533 / 0 AT3G07870 101 / 3e-23 F-box and associated interaction domains-containing protein (.1)
Potri.001G396800 199 / 2e-60 AT3G07870 99 / 2e-22 F-box and associated interaction domains-containing protein (.1)
Potri.008G216000 185 / 1e-56 AT1G47340 65 / 9e-12 F-box and associated interaction domains-containing protein (.1)
Potri.011G137200 187 / 8e-56 AT3G07870 94 / 1e-20 F-box and associated interaction domains-containing protein (.1)
Potri.001G129200 141 / 1e-38 AT3G07870 110 / 8e-27 F-box and associated interaction domains-containing protein (.1)
Potri.004G000900 132 / 5e-35 AT4G12560 87 / 2e-18 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.001G129400 114 / 1e-28 AT4G12560 100 / 3e-23 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.002G223000 107 / 3e-26 AT3G07870 467 / 5e-164 F-box and associated interaction domains-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006403 108 / 4e-27 AT3G07870 362 / 2e-124 F-box and associated interaction domains-containing protein (.1)
Lus10012355 108 / 2e-26 AT3G07870 393 / 2e-135 F-box and associated interaction domains-containing protein (.1)
Lus10036105 90 / 9e-20 AT3G07870 206 / 1e-61 F-box and associated interaction domains-containing protein (.1)
Lus10039024 79 / 4e-16 AT4G12560 333 / 3e-111 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Lus10008871 79 / 5e-16 AT4G12560 135 / 1e-35 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Lus10038603 74 / 2e-14 AT3G06240 110 / 2e-26 F-box family protein (.1)
Lus10013873 69 / 8e-13 AT3G06240 104 / 2e-24 F-box family protein (.1)
Lus10023238 66 / 6e-12 AT3G23880 126 / 6e-33 F-box and associated interaction domains-containing protein (.1)
Lus10038606 66 / 1e-11 AT3G07870 112 / 1e-27 F-box and associated interaction domains-containing protein (.1)
Lus10037892 64 / 3e-11 AT3G06240 107 / 7e-26 F-box family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0162 FBA PF07734 FBA_1 F-box associated
Representative CDS sequence
>Potri.008G216223.1 pacid=42806553 polypeptide=Potri.008G216223.1.p locus=Potri.008G216223 ID=Potri.008G216223.1.v4.1 annot-version=v4.1
ATGAAGTTTGTTCCCGGAATCAACGTACCCTATAATGATTTCTTGATTGAAAACTCTTGTAATGGGCTTCTTTGCATTTCTCAAACCTTCCAAGACGGCT
CCCATGATGACATTTATTTGTGCAATCCAATTTTGGGGGAGTATATCTCCATTCCACCCGCTGCTGGTCAAGAAACAAGGCATCAGAGTAATTTCGCTTT
GGGATACTGTGCCATTGCTAAAGAATACAAAGTGTTGCACACTTTTTGTTCGAAGACAGGGTCTTATTACCAACCTGAGGCTGAAATATACACGATTGGT
ACAGGGAAATGGAGAAGTATTCAAAAAGCTCTTCTTAATCTTCGTATGTTCATTGTCGATAGTTTTGTGTGCGGATCAATCCATTGGGAACTTCGTGATG
AAGACGATTGTGTGAATAGTATAGGTTCTTTTAACTTTGAGAATGAGCAATTTAGCGAATTGTCCTTGCCGCCTCGCTATGATGAGGGCGATGTCACTTT
GACAGCTTTTGAAGGTTGCCTGGGCGTGTCTTTCTTCCACACCTATTCTGATCCTCAATATGAAATATGGATTATGAAGGAGTATGGGAACAAGGAGTCT
TGGACCAAACAATTTACCGTCAAGAACCTAGGTTTTGCCAAGCTTTATGATCCCTTGATTTTCTTGAACAATGGATTAATCTTGATGATGCAATATCGTG
AATTTGTCGTTTGTTATGACACAAGAAGGAAATTCATGGAAATTATTAGAATATGGCAGACTCAGGGAAATAATTATGCAATTGCATACAAACCATCCTT
TGTTTCGCTGAAGGATGTAGGAAAAGGAGAACAGTTGAAGATGTCAAGGAAGCAAGCTGGTAGAGAAGATGACGAGTCCTCTTCTGAAGGAGCATATAAC
TGCACCAGTCATGATCAACTTTCTGAGAGCATTCCTCCACAACACTCTGCAGAGTTTTTACCTGTTATTGCAAGTTCATGA
AA sequence
>Potri.008G216223.1 pacid=42806553 polypeptide=Potri.008G216223.1.p locus=Potri.008G216223 ID=Potri.008G216223.1.v4.1 annot-version=v4.1
MKFVPGINVPYNDFLIENSCNGLLCISQTFQDGSHDDIYLCNPILGEYISIPPAAGQETRHQSNFALGYCAIAKEYKVLHTFCSKTGSYYQPEAEIYTIG
TGKWRSIQKALLNLRMFIVDSFVCGSIHWELRDEDDCVNSIGSFNFENEQFSELSLPPRYDEGDVTLTAFEGCLGVSFFHTYSDPQYEIWIMKEYGNKES
WTKQFTVKNLGFAKLYDPLIFLNNGLILMMQYREFVVCYDTRRKFMEIIRIWQTQGNNYAIAYKPSFVSLKDVGKGEQLKMSRKQAGREDDESSSEGAYN
CTSHDQLSESIPPQHSAEFLPVIASS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G07870 F-box and associated interacti... Potri.008G216223 0 1
Potri.011G167566 6.78 0.8481
AT2G23440 unknown protein Potri.007G041500 13.00 0.8582
AT1G09030 CCAAT NF-YB4 "nuclear factor Y, subunit B4"... Potri.013G019500 21.49 0.8445
Potri.001G093650 21.49 0.6927
AT4G20800 FAD-binding Berberine family p... Potri.001G459100 21.90 0.8445
AT4G13510 ATAMT1;1, AMT1;... ARABIDOPSIS THALIANA AMMONIUM ... Potri.013G049925 31.70 0.8348
AT2G14610 PR-1, PR1, ATPR... pathogenesis-related gene 1 (.... Potri.009G082800 40.86 0.8230
AT1G11925 Stigma-specific Stig1 family p... Potri.011G009100 41.42 0.8220
AT2G28160 bHLH ATFIT1, ATBHLH2... ARABIDOPSIS FE-DEFICIENCY INDU... Potri.009G005600 42.33 0.8268
AT2G21610 PE11, ATPE11 A. THALIANA PECTINESTERASE 11,... Potri.004G156300 42.89 0.8244

Potri.008G216223 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.