Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G21420 236 / 8e-76 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G78550 106 / 2e-26 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17010 105 / 5e-26 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G38240 105 / 6e-26 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17020 102 / 8e-25 ATSRG1, SRG1 senescence-related gene 1 (.1) AT5G05600 101 / 2e-24 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G25300 100 / 3e-24 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G11180 91 / 2e-20 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G49390 85 / 2e-18 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G55970 84 / 4e-18 ATJRG21 jasmonate-regulated gene 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G023600 [exp] 381 / 4e-133 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G023550 [exp] 226 / 2e-74 AT3G21420 210 / 6e-68 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G201000 [exp] 119 / 6e-31 AT3G21420 290 / 5e-96 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G382400 [exp] 113 / 6e-29 AT1G17020 446 / 1e-157 senescence-related gene 1 (.1) Potri.001G355100 [exp] 112 / 1e-28 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1) Potri.009G025900 [exp] 111 / 3e-28 AT4G25300 410 / 3e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.001G381700 [exp] 108 / 4e-27 AT1G17020 436 / 2e-153 senescence-related gene 1 (.1) Potri.010G200900 [exp] 108 / 4e-27 AT3G21420 288 / 4e-95 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G355200 [exp] 98 / 3e-23 AT1G17020 329 / 3e-111 senescence-related gene 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006518 [exp] 290 / 7e-97 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10004808 [exp] 104 / 1e-25 AT5G05600 457 / 5e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10015252 [exp] 102 / 6e-25 AT1G17020 375 / 1e-129 senescence-related gene 1 (.1) Lus10026173 [exp] 99 / 2e-23 AT1G17020 443 / 5e-156 senescence-related gene 1 (.1) Lus10011985 [exp] 97 / 9e-23 AT1G17020 367 / 4e-126 senescence-related gene 1 (.1) Lus10011986 [exp] 97 / 1e-22 AT1G17020 291 / 3e-96 senescence-related gene 1 (.1) Lus10005037 [exp] 96 / 2e-22 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10011980 [exp] 95 / 5e-22 AT1G17020 382 / 1e-132 senescence-related gene 1 (.1) Lus10030995 [exp] 94 / 1e-21 AT1G17020 339 / 2e-115 senescence-related gene 1 (.1) Lus10011979 [exp] 91 / 8e-21 AT1G17020 374 / 4e-129 senescence-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.008G217200.2 pacid=42807493 polypeptide=Potri.008G217200.2.p locus=Potri.008G217200 ID=Potri.008G217200.2.v4.1 annot-version=v4.1 ATGTCTCCTGTTTCAATGGCTCCAATTAGGGTTGGTCATTTTGATGATGTTCAAGAGCTTAGAAAGGACAGGCCAACAACAATCCCTGAAAGATTTGTTA GGAACATGACAGAAAGACCAGCACCAGCCACAGTTCTACCATCTCTCAGTACCATTCCCACCATTGATTTCTCAAGGCTTGCTGAAGGCAATAAAGATAA ATACAAAAGTGAGATGTTGGAGCTGACAAGAGCGTGCGAGGAATGGGGATTTTTTTCAGGTGTCTTTAAAATGTTTTATCAGGTGATTGACCATGGGATT GATCTGAGTTTGCTGGAGAGCATAGAGAAGGTGGCCATGGATTTCTTCGTGCTGCCTTTAGGGGAGAAGCAGAAGTATCCAATATTCCAATTCCAAAAGC TGGACTGGGTCAATATGATTGCTCTTGGGCTTGAGCCCCACTCTATAAGGGTCCCAAAACCAGGGCCAGCAAAGCCACCCAAGTTCAGTGAAACTGTGGA GGAGAAGTGTCAGCATCTACTGAAATATATAGGCATGACACTACACATGAGAGCAGATGTTTTTGAAGAGATACCGGACCTTGTTTTAGGTCTTAGTCCA CATTCAGATGGAAGTGCCCTTCCAGTGTTGCAGCAAGGGAGGGGTAGTTCAGTAAGAAAGCACACTGGTTTTAACAAATGGAAAATACCAAAGTGTGGAG CATTGACTCACAGGGAAAAAGACAGACTCTCTCTTGTCACATTTTATTCCCCTAGCTATGAAATAGAGCTTGGACCAATTCCAGAGCTGTTGGATGAGAA CAATCCATGCAAGTGTAGGAGATACCTGCAAGGCAAGAAGAACCTGGAATTTGCCAAAGTTGAAAGCAAGAAACCTACTTAA
AA sequence Show only first row Show all	>Potri.008G217200.2 pacid=42807493 polypeptide=Potri.008G217200.2.p locus=Potri.008G217200 ID=Potri.008G217200.2.v4.1 annot-version=v4.1 MSPVSMAPIRVGHFDDVQELRKDRPTTIPERFVRNMTERPAPATVLPSLSTIPTIDFSRLAEGNKDKYKSEMLELTRACEEWGFFSGVFKMFYQVIDHGI DLSLLESIEKVAMDFFVLPLGEKQKYPIFQFQKLDWVNMIALGLEPHSIRVPKPGPAKPPKFSETVEEKCQHLLKYIGMTLHMRADVFEEIPDLVLGLSP HSDGSALPVLQQGRGSSVRKHTGFNKWKIPKCGALTHREKDRLSLVTFYSPSYEIELGPIPELLDENNPCKCRRYLQGKKNLEFAKVESKKPT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G21420		LBO1	LATERAL BRANCHING OXIDOREDUCTA...		Potri.008G217200 [exp]	0	1
AT1G22170			Phosphoglycerate mutase family...		Potri.005G078100 [exp]	7.21	0.8315
AT1G30290			Tetratricopeptide repeat (TPR)...		Potri.011G082300 [exp]	8.94	0.8954
					Potri.014G065300 [exp]	15.36	0.8822
AT5G14010	C2H2ZnF	KNUCKLES, KNU	KNUCKLES, C2H2 and C2HC zinc f...		Potri.010G140700 [exp]	17.40	0.8017
					Potri.003G013856 [exp]	19.89	0.8796
AT1G67025			unknown protein		Potri.017G117230 [exp]	23.66	0.8747
AT5G07900			Mitochondrial transcription te...		Potri.003G189300 [exp]	25.45	0.8114
					Potri.009G083702 [exp]	26.32	0.8024
					Potri.014G061700 [exp]	28.00	0.8713
					Potri.005G150150 [exp]	31.11	0.8661

Compare expression of checked genes

Potri.008G217200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.