Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11925 74 / 2e-17 Stigma-specific Stig1 family protein (.1) AT1G53130 68 / 8e-15 GRI GRIM REAPER, Stigma-specific Stig1 family protein (.1) AT1G50650 67 / 2e-14 Stigma-specific Stig1 family protein (.1) AT4G26880 62 / 7e-13 Stigma-specific Stig1 family protein (.1) AT1G50720 59 / 9e-12 Stigma-specific Stig1 family protein (.1) AT5G55110 55 / 6e-10 Stigma-specific Stig1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G009100 [exp] 76 / 5e-18 AT1G11925 125 / 2e-37 Stigma-specific Stig1 family protein (.1) Potri.011G008804 [exp] 75 / 8e-18 AT1G11925 98 / 8e-27 Stigma-specific Stig1 family protein (.1) Potri.011G009000 [exp] 75 / 1e-17 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1) Potri.010G228100 [exp] 74 / 3e-17 AT1G11925 94 / 2e-25 Stigma-specific Stig1 family protein (.1) Potri.004G007000 [exp] 71 / 2e-16 AT1G11925 96 / 5e-26 Stigma-specific Stig1 family protein (.1) Potri.001G399200 [exp] 69 / 2e-15 AT1G53130 149 / 2e-46 GRIM REAPER, Stigma-specific Stig1 family protein (.1) Potri.004G007100 [exp] 68 / 4e-15 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1) Potri.004G006900 [exp] 67 / 6e-15 AT1G11925 108 / 4e-31 Stigma-specific Stig1 family protein (.1) Potri.004G030900 [exp] 68 / 7e-15 AT1G11925 101 / 4e-28 Stigma-specific Stig1 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006512 [exp] 132 / 3e-40 AT1G50650 71 / 5e-16 Stigma-specific Stig1 family protein (.1) Lus10041930 [exp] 66 / 5e-14 AT1G53130 152 / 1e-47 GRIM REAPER, Stigma-specific Stig1 family protein (.1) Lus10005544 [exp] 63 / 1e-13 AT1G53130 125 / 6e-38 GRIM REAPER, Stigma-specific Stig1 family protein (.1) Lus10000696 [exp] 63 / 1e-12 AT1G50650 100 / 3e-26 Stigma-specific Stig1 family protein (.1) Lus10043047 [exp] 57 / 8e-11 AT1G50720 133 / 3e-40 Stigma-specific Stig1 family protein (.1) Lus10011146 [exp] 55 / 6e-10 AT1G50720 125 / 2e-37 Stigma-specific Stig1 family protein (.1) Lus10020831 [exp] 54 / 1e-09 AT1G11925 100 / 7e-28 Stigma-specific Stig1 family protein (.1) Lus10012679 [exp] 54 / 2e-09 AT1G11925 104 / 3e-29 Stigma-specific Stig1 family protein (.1) Lus10011117 [exp] 52 / 1e-08 AT1G50720 117 / 6e-34 Stigma-specific Stig1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04885 [poplar] [flax] Stig1 Stigma-specific protein, Stig1
Representative CDS sequence Show only first row Show all	>Potri.008G220900.1 pacid=42807893 polypeptide=Potri.008G220900.1.p locus=Potri.008G220900 ID=Potri.008G220900.1.v4.1 annot-version=v4.1 ATGTTATGCTATGATGCCAATGTCAAATACCTGTGGTCTTTCATCTTGTTTCTGTTAGTTGTAGCTCCCGACGAGGTTGTCGCTGCCGACCGGTTTGGTT CGCCAGAGCCGGACACTCCTACACACCTGAACTTCTTCCGGTCGGCATTGCGGGGGAGGCAAAGAGTTTTGTCATGTGCCGATGATCCTAGAGTGTGTGT GGATCGCGGGAAGAACCCATGGGGAGGCAGCACATGTTGCTTCAGGAAATTCTGCAAGGATACCTTGAGGGATTCGGACAATTGTGGGGCATGTGGGCAG ACATGTGCTTATGGATTTGTTTGCTGCGATGGAAAGTGTGTTGATATTCGAAATGATCCACGCCATTGTGGTTCTTGTTTTCAGGAGTGTCCTGGACAAG GTAGGTGCTCCTTTGCAATGTGTGATTATAGTGGATGA
AA sequence Show only first row Show all	>Potri.008G220900.1 pacid=42807893 polypeptide=Potri.008G220900.1.p locus=Potri.008G220900 ID=Potri.008G220900.1.v4.1 annot-version=v4.1 MLCYDANVKYLWSFILFLLVVAPDEVVAADRFGSPEPDTPTHLNFFRSALRGRQRVLSCADDPRVCVDRGKNPWGGSTCCFRKFCKDTLRDSDNCGACGQ TCAYGFVCCDGKCVDIRNDPRHCGSCFQECPGQGRCSFAMCDYSG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G11925			Stigma-specific Stig1 family p...		Potri.008G220900 [exp]	0	1
AT2G46850			Protein kinase superfamily pro...		Potri.002G181100 [exp]	2.00	0.9490
AT3G07990		SCPL27	serine carboxypeptidase-like 2...		Potri.010G220200 [exp]	3.46	0.9559
AT1G53708		RTFL9	ROTUNDIFOLIA like 9 (.1)		Potri.003G073900 [exp]	4.89	0.9451
AT1G14040			EXS (ERD1/XPR1/SYG1) family pr...		Potri.010G165300 [exp]	5.47	0.9419
AT1G05260		RCI3A, RCI3	RARE COLD INDUCIBLE GENE 3, Pe...		Potri.007G122100 [exp]	6.00	0.9501	SEPA1.1
AT1G17020		ATSRG1, SRG1	senescence-related gene 1 (.1)		Potri.009G022800 [exp]	6.32	0.9479
AT1G78780			pathogenesis-related family pr...		Potri.001G389800 [exp]	8.06	0.9344
AT5G13900			Bifunctional inhibitor/lipid-t...		Potri.013G131500 [exp]	10.48	0.9408
AT1G51190	AP2_ERF	PLT2	PLETHORA 2, Integrase-type DNA...		Potri.003G205700 [exp]	14.07	0.9419	RAP23
AT5G17430	AP2_ERF	BBM	BABY BOOM, Integrase-type DNA-...		Potri.010G181000 [exp]	14.96	0.9446

Compare expression of checked genes

Potri.008G220900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.