Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48290 148 / 7e-42 CYP71A24 "cytochrome P450, family 71, subfamily A, polypeptide 24", cytochrome P450, family 71, subfamily A, polypeptide 24 (.1.2) AT3G48270 138 / 3e-38 CYP71A26 "cytochrome P450, family 71, subfamily A, polypeptide 26", cytochrome P450, family 71, subfamily A, polypeptide 26 (.1) AT3G48280 137 / 5e-38 CYP71A25 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) AT5G24950 136 / 1e-37 CYP71A15 "cytochrome P450, family 71, subfamily A, polypeptide 15", cytochrome P450, family 71, subfamily A, polypeptide 15 (.1) AT3G48310 134 / 1e-36 CYP71A22 "cytochrome P450, family 71, subfamily A, polypeptide 22", cytochrome P450, family 71, subfamily A, polypeptide 22 (.1) AT3G48320 134 / 1e-36 CYP71A21 "cytochrome P450, family 71, subfamily A, polypeptide 21", cytochrome P450, family 71, subfamily A, polypeptide 21 (.1) AT3G48300 132 / 3e-36 CYP71A23 "cytochrome P450, family 71, subfamily A, polypeptide 23", cytochrome P450, family 71, subfamily A, polypeptide 23 (.1) AT4G13310 127 / 5e-35 CYP71A20 "cytochrome P450, family 71, subfamily A, polypeptide 20", cytochrome P450, family 71, subfamily A, polypeptide 20 (.1.2) AT4G13290 129 / 9e-35 CYP71A19 "cytochrome P450, family 71, subfamily A, polypeptide 19", cytochrome P450, family 71, subfamily A, polypeptide 19 (.1) AT4G31500 127 / 3e-34 SUR2, RNT1, RED1, ATR4, CYP83B1 SUPERROOT 2, RUNT 1, RED ELONGATED 1, "cytochrome P450, family 83, subfamily B, polypeptide 1", ALTERED TRYPTOPHAN REGULATION 4, cytochrome P450, family 83, subfamily B, polypeptide 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G074300 [exp] 252 / 1e-81 AT3G26300 343 / 6e-113 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.011G131051 [exp] 226 / 3e-73 AT3G48280 218 / 9e-67 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Potri.007G074850 [exp] 225 / 2e-71 AT3G26300 379 / 1e-126 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G074900 [exp] 224 / 8e-71 AT3G26300 383 / 3e-128 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.011G130850 [exp] 223 / 1e-70 AT3G26300 361 / 5e-120 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G075000 [exp] 223 / 2e-70 AT3G26300 386 / 2e-129 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.011G130800 [exp] 222 / 3e-70 AT3G26300 359 / 4e-119 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.008G223500 [exp] 175 / 6e-52 AT3G26300 395 / 3e-133 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.015G094900 [exp] 167 / 2e-49 AT1G13110 268 / 4e-84 "cytochrome P450, family 71 subfamily B, polypeptide 7", cytochrome P450, family 71 subfamily B, polypeptide 7 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002885 [exp] 169 / 2e-49 AT3G48280 396 / 2e-133 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10030708 [exp] 166 / 1e-48 AT3G26210 390 / 6e-131 "cytochrome P450, family 71, subfamily B, polypeptide 23", cytochrome P450, family 71, subfamily B, polypeptide 23 (.1) Lus10019157 [exp] 164 / 1e-47 AT3G48300 358 / 1e-118 "cytochrome P450, family 71, subfamily A, polypeptide 23", cytochrome P450, family 71, subfamily A, polypeptide 23 (.1) Lus10042815 [exp] 159 / 6e-46 AT1G13110 396 / 3e-133 "cytochrome P450, family 71 subfamily B, polypeptide 7", cytochrome P450, family 71 subfamily B, polypeptide 7 (.1) Lus10012767 [exp] 157 / 4e-45 AT3G26210 386 / 1e-129 "cytochrome P450, family 71, subfamily B, polypeptide 23", cytochrome P450, family 71, subfamily B, polypeptide 23 (.1) Lus10016601 [exp] 156 / 6e-45 AT3G26320 402 / 6e-136 "cytochrome P450, family 71, subfamily B, polypeptide 36", cytochrome P450, family 71, subfamily B, polypeptide 36 (.1) Lus10026252 [exp] 158 / 2e-44 AT5G25120 383 / 2e-123 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) Lus10009903 [exp] 155 / 3e-44 AT5G57260 376 / 1e-125 "cytochrome P450, family 71, subfamily B, polypeptide 10", cytochrome P450, family 71, subfamily B, polypeptide 10 (.1) Lus10013194 [exp] 154 / 4e-44 AT5G25120 387 / 9e-130 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) Lus10028926 [exp] 154 / 8e-44 AT3G26330 382 / 3e-127 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.008G223166.1 pacid=42805980 polypeptide=Potri.008G223166.1.p locus=Potri.008G223166 ID=Potri.008G223166.1.v4.1 annot-version=v4.1 ATGCAGCAGGAAATTCCCCTTGTCCTGGGCTTCCTTCTCCTTGTCTTCGCTGTGTTGAGATTAGGGAAGAAATCAAAAGGCCATGACTCAACTCGCACAC CACCTCCGGGACCATGGAAATTACCCTTAATTGGAAACATCCATCAGCTAGCTAGCTCTGCAACAATGCCCCATTATCTCTGTGCGCATTGGGCCAAGAA ATACGGACCAATCATGCAAATTCAGATTGGAGAAGTTCCTACTGTTATTATTTCTTCACCAGACGCAGCAAAAGAAGTATTGAAGACGCAGGAAATCAAC TTTGCTGAAAGACCAGCTCTCCTTGTTTCAGAAATCATGCTTTACAATGGCCAGGGCATGTCATTTGCAAAATTTGGAGACCACTGGAAACTAATGCGAA AAGCATGCATATGGGGGCTATTTAGTGCAACACGTAAACTCTCATTCAGATCAATCAGGGAAGAAGAGGTATCAAATTTAATCAGCTCCATCCGTTCGAA AGAAGGTTCGCCAATCAACCTCAGGGAATTGCTTTTGGATTTGTCAAATGAAACTATTACAAGAACAAGCATTGGTAAGAAATGCAAAAACAAAGCTCGA TTTTTACACACTATTGAACAAGTGTCAAAGTCAGTAGGAGGTGTGAATATTTTTTTGTAA
AA sequence Show only first row Show all	>Potri.008G223166.1 pacid=42805980 polypeptide=Potri.008G223166.1.p locus=Potri.008G223166 ID=Potri.008G223166.1.v4.1 annot-version=v4.1 MQQEIPLVLGFLLLVFAVLRLGKKSKGHDSTRTPPPGPWKLPLIGNIHQLASSATMPHYLCAHWAKKYGPIMQIQIGEVPTVIISSPDAAKEVLKTQEIN FAERPALLVSEIMLYNGQGMSFAKFGDHWKLMRKACIWGLFSATRKLSFRSIREEEVSNLISSIRSKEGSPINLRELLLDLSNETITRTSIGKKCKNKAR FLHTIEQVSKSVGGVNIFL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G48290		CYP71A24	"cytochrome P450, family 71, s...		Potri.008G223166 [exp]	0	1
					Potri.005G073733 [exp]	3.46	0.9355
AT4G24700			unknown protein		Potri.012G086000 [exp]	4.89	0.9351
AT2G39370		MAKR4	MEMBRANE-ASSOCIATED KINASE REG...		Potri.010G212800 [exp]	7.34	0.9232
					Potri.014G018801 [exp]	7.74	0.9089
					Potri.005G026425 [exp]	10.00	0.9143
AT5G54850			unknown protein		Potri.011G136600 [exp]	10.19	0.8998
AT1G75390	bZIP	ATBZIP44	basic leucine-zipper 44 (.1.2)		Potri.004G158200 [exp]	12.04	0.8777
					Potri.004G063101 [exp]	14.14	0.9018
AT5G56320		ATHEXPALPHA1.5,...	EXPANSIN 14, expansin A14 (.1)		Potri.003G223501 [exp]	15.81	0.9018
AT3G04890			Uncharacterized conserved prot...		Potri.013G037050 [exp]	17.32	0.8441

Compare expression of checked genes

Potri.008G223166 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.