Potri.008G224084 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G13160 73 / 1e-15 PBS1 avrPphB susceptible 1, Protein kinase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G060800 117 / 1e-31 AT5G13160 714 / 0.0 avrPphB susceptible 1, Protein kinase superfamily protein (.1)
Potri.003G166900 117 / 1e-31 AT5G13160 745 / 0.0 avrPphB susceptible 1, Protein kinase superfamily protein (.1)
Potri.010G021500 47 / 2e-06 AT5G18610 779 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.008G205700 45 / 6e-06 AT5G18610 783 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.017G067900 40 / 0.0002 AT5G13160 434 / 3e-150 avrPphB susceptible 1, Protein kinase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015756 65 / 8e-13 AT5G13160 732 / 0.0 avrPphB susceptible 1, Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.008G224084.1 pacid=42807813 polypeptide=Potri.008G224084.1.p locus=Potri.008G224084 ID=Potri.008G224084.1.v4.1 annot-version=v4.1
ATGGAAGAGAACGGCTTACCTGCTTCTGGAGATGGCGAGGAGGCTTACAGCGCAGTGGTTTTACTCTCGTCTGCGTATGACTTTCCCTTCTGTTTTCCTT
TTGTTTCTGTGATGATGAAGGTGACGGCTTTCTGTTTAGGTTCTTCTTTTTCTGATTTGCAGGAGGCGATCAAGAAGACGGTGACATTAACGTTGGTCTT
CTGGGTTTTCTGCTTGAGTTTGTCTCTGTTTTTCTCTGTGTGCTCTCTTTTTTTCTGTTTTTCTGGGTTTCCTTTTTTCTGCTCCTTGATTTTTTCTCCC
CACATCTTGGCCTCAACAACTGCTCGTTCTCTATCTAAATCCCTGTTTAACATCTTAGCAGTTTCTCTTGGTGAGTCCTCTTTCTCGGACCCATCCAAGT
CCCATCTGCGTCCCGATCCTCCACCTTCCTCATTCCTTGATAACTGTCCACCTCTCTCATCTCTCTGTCTTTTTTAA
AA sequence
>Potri.008G224084.1 pacid=42807813 polypeptide=Potri.008G224084.1.p locus=Potri.008G224084 ID=Potri.008G224084.1.v4.1 annot-version=v4.1
MEENGLPASGDGEEAYSAVVLLSSAYDFPFCFPFVSVMMKVTAFCLGSSFSDLQEAIKKTVTLTLVFWVFCLSLSLFFSVCSLFFCFSGFPFFCSLIFSP
HILASTTARSLSKSLFNILAVSLGESSFSDPSKSHLRPDPPPSSFLDNCPPLSSLCLF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G13160 PBS1 avrPphB susceptible 1, Protein... Potri.008G224084 0 1
AT5G62740 AtHIR4, ATHIR1 hypersensitive induced reactio... Potri.015G065001 10.09 0.8894
AT5G42920 AtTHO5 THO complex, subunit 5 (.1.2) Potri.002G125300 10.48 0.8910
Potri.006G062150 20.24 0.8768
AT2G45260 Plant protein of unknown funct... Potri.014G067600 23.62 0.8712
AT4G19110 Protein kinase superfamily pro... Potri.003G190200 24.67 0.8588
AT1G79580 NAC ANAC033, SMB, N... NAC (No Apical Meristem) domai... Potri.019G063000 24.97 0.8543
AT2G26060 EMB1345 embryo defective 1345, Transdu... Potri.001G221150 29.39 0.8393
AT2G37980 O-fucosyltransferase family pr... Potri.006G095300 48.37 0.8591
Potri.002G161801 50.99 0.8543
AT5G17770 CBR1, ATCBR NADH:cytochrome B5 reductase 1... Potri.007G072750 51.49 0.8681

Potri.008G224084 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.