Potri.009G001301 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.009G001301.1 pacid=42771667 polypeptide=Potri.009G001301.1.p locus=Potri.009G001301 ID=Potri.009G001301.1.v4.1 annot-version=v4.1
ATGGAGAGGTGGTCACTGGTCAAGGTCAAGAACATTAGCAAAGAGGAGGGGAAAATGGAAGTGTTGAGGGAAATCGAGCAGGAGCAGCATAGAAGGCACA
AAACACCTTTTAACTTTTCCTGGAATTTTACATATTGGTTTTCTCTGTCAAGCTTAGATGGTTGTGTTATGAATGATTCTGTTCTCTATCTGTGCCTATT
AGTATATTTAAGGGGTTTGATTGTAAGACATTTTATTGAGAATTTGATGCTGACCGACATGAAAGTAGTATTGGCCAAGTGGGTTTTTGTAGTTCTTTTT
TATTTACTTCACTTTTCAATTTTGGCATCAAGTTAA
AA sequence
>Potri.009G001301.1 pacid=42771667 polypeptide=Potri.009G001301.1.p locus=Potri.009G001301 ID=Potri.009G001301.1.v4.1 annot-version=v4.1
MERWSLVKVKNISKEEGKMEVLREIEQEQHRRHKTPFNFSWNFTYWFSLSSLDGCVMNDSVLYLCLLVYLRGLIVRHFIENLMLTDMKVVLAKWVFVVLF
YLLHFSILASS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.009G001301 0 1
Potri.003G149300 4.89 0.8863
AT5G62220 ATGT18 glycosyltransferase 18 (.1) Potri.015G132600 5.56 0.8273
AT1G55000 peptidoglycan-binding LysM dom... Potri.013G021600 6.16 0.8927
AT5G12840 CCAAT NF-YA1, ATHAP2A... "nuclear factor Y, subunit A1"... Potri.009G052900 7.48 0.8496 HAP2.5
Potri.012G100001 7.48 0.8698
AT5G26770 unknown protein Potri.013G003400 7.87 0.8016
AT1G16180 Serinc-domain containing serin... Potri.001G038100 8.36 0.8576
AT4G29040 RPT2A regulatory particle AAA-ATPase... Potri.014G194700 8.48 0.8582
AT2G41900 C3HZnF OXS2 OXIDATIVE STRESS 2, CCCH-type ... Potri.001G266700 9.53 0.8500
AT3G06060 TSC10A TSC10A, NAD(P)-binding Rossman... Potri.010G191800 10.67 0.8221

Potri.009G001301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.