Potri.009G003200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27930 227 / 4e-76 PLATZ transcription factor family protein (.1)
AT1G76590 191 / 5e-61 PLATZ transcription factor family protein (.1)
AT1G21000 187 / 7e-60 PLATZ transcription factor family protein (.1.2)
AT4G17900 184 / 8e-59 PLATZ transcription factor family protein (.1.2)
AT1G32700 182 / 3e-58 PLATZ transcription factor family protein (.1.2)
AT1G43000 177 / 3e-56 PLATZ transcription factor family protein (.1)
AT5G46710 166 / 7e-52 PLATZ transcription factor family protein (.1)
AT1G31040 122 / 2e-34 PLATZ transcription factor family protein (.1)
AT2G12646 122 / 3e-34 PLATZ transcription factor family protein (.1)
AT3G60670 110 / 1e-29 PLATZ transcription factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G212400 348 / 8e-124 AT2G27930 224 / 6e-75 PLATZ transcription factor family protein (.1)
Potri.006G119400 288 / 4e-100 AT2G27930 212 / 3e-70 PLATZ transcription factor family protein (.1)
Potri.016G097100 276 / 2e-95 AT1G32700 200 / 3e-65 PLATZ transcription factor family protein (.1.2)
Potri.019G051200 197 / 1e-63 AT4G17900 309 / 2e-107 PLATZ transcription factor family protein (.1.2)
Potri.005G259000 196 / 2e-63 AT1G21000 366 / 1e-129 PLATZ transcription factor family protein (.1.2)
Potri.003G092800 195 / 3e-63 AT4G17900 290 / 5e-100 PLATZ transcription factor family protein (.1.2)
Potri.002G002200 194 / 9e-63 AT1G21000 365 / 2e-129 PLATZ transcription factor family protein (.1.2)
Potri.013G078500 193 / 3e-62 AT4G17900 312 / 1e-108 PLATZ transcription factor family protein (.1.2)
Potri.001G141500 192 / 7e-62 AT4G17900 302 / 5e-105 PLATZ transcription factor family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027735 267 / 1e-91 AT1G21000 218 / 9e-72 PLATZ transcription factor family protein (.1.2)
Lus10035554 258 / 4e-88 AT1G21000 221 / 4e-73 PLATZ transcription factor family protein (.1.2)
Lus10014396 226 / 5e-75 AT1G76590 202 / 7e-66 PLATZ transcription factor family protein (.1)
Lus10002700 191 / 1e-60 AT1G21000 345 / 1e-120 PLATZ transcription factor family protein (.1.2)
Lus10000952 190 / 1e-60 AT1G21000 347 / 5e-122 PLATZ transcription factor family protein (.1.2)
Lus10040292 186 / 2e-59 AT1G21000 317 / 3e-110 PLATZ transcription factor family protein (.1.2)
Lus10000482 186 / 4e-59 AT4G17900 284 / 2e-97 PLATZ transcription factor family protein (.1.2)
Lus10040082 186 / 4e-59 AT4G17900 306 / 2e-106 PLATZ transcription factor family protein (.1.2)
Lus10023411 187 / 2e-58 AT1G21000 313 / 7e-107 PLATZ transcription factor family protein (.1.2)
Lus10030968 184 / 2e-58 AT4G17900 299 / 1e-103 PLATZ transcription factor family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00643 zf-B_box B-box zinc finger
PF04640 PLATZ PLATZ transcription factor
Representative CDS sequence
>Potri.009G003200.2 pacid=42771795 polypeptide=Potri.009G003200.2.p locus=Potri.009G003200 ID=Potri.009G003200.2.v4.1 annot-version=v4.1
ATGGAAATGTTGGTACCACCATGGCTTGAATCATTATTGTCGGCTGCATTCTTCACCATTTGCCCCAGGCATAGAGAAGCCCCACGTAGCGAATGCAACA
TGTTCTGCCTTGATTGCAACACCGATTCCTTTTGCTTCTATTGCCGATCAACTCAGCACAAAGATCATCCTGTTATTCAAATCAGAAGGTCATCGTATCA
TGATGTTGTTAGGGTTGCTGAGATTCAAAAGGTTTTGGACATTAGTGGAGTTCAAACTTACGTTATAAACAGTGCTAGAGTTCTTTTCCTTAATGAGAGA
CCACAACCTAAGAGTAGCACTAGTAAAGGAGTCTCTCATTTATGCCAAATCTGTGGGAGAAGTCTTCTGGATCCCTTTCGTTTCTGTTCTTTGGGATGTA
AGCTTGTAGGAATAAAGAACAGTGGAGATACCAACTTTAACTTAAGCACCAAGAACGAGGAAAATAGAGATGGAATGGCAAGAAGATTGCCATTAAAGGA
AGAAGAAGAATTGCGTGAAGGAAGCCAGCAAGACATGTACAAAAGCACGCCAATTCCACCACATTCTACTTCAAGAAGGAGAAAAGGCATCCCCCATAGG
GCACCTTTAGGACCCTAA
AA sequence
>Potri.009G003200.2 pacid=42771795 polypeptide=Potri.009G003200.2.p locus=Potri.009G003200 ID=Potri.009G003200.2.v4.1 annot-version=v4.1
MEMLVPPWLESLLSAAFFTICPRHREAPRSECNMFCLDCNTDSFCFYCRSTQHKDHPVIQIRRSSYHDVVRVAEIQKVLDISGVQTYVINSARVLFLNER
PQPKSSTSKGVSHLCQICGRSLLDPFRFCSLGCKLVGIKNSGDTNFNLSTKNEENRDGMARRLPLKEEEELREGSQQDMYKSTPIPPHSTSRRRKGIPHR
APLGP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G27930 PLATZ transcription factor fam... Potri.009G003200 0 1
AT5G05950 MEE60 maternal effect embryo arrest ... Potri.009G038500 1.41 0.9130
AT1G43790 TED6 tracheary element differentiat... Potri.002G072000 4.58 0.8588
AT1G13195 RING/U-box superfamily protein... Potri.010G053000 10.95 0.8161
AT1G20850 XCP2 xylem cysteine peptidase 2 (.1... Potri.002G005700 11.22 0.8347
AT1G26820 RNS3 ribonuclease 3 (.1) Potri.008G086800 16.43 0.8142 S.4
AT5G66980 B3 AP2/B3-like transcriptional fa... Potri.007G035500 18.97 0.8467
AT4G00080 UNE11 unfertilized embryo sac 11, Pl... Potri.014G067500 19.69 0.8563
AT1G06340 Plant Tudor-like protein (.1) Potri.009G151200 20.71 0.7088
AT4G27290 S-locus lectin protein kinase ... Potri.010G017900 24.81 0.8382
AT5G66910 Disease resistance protein (CC... Potri.007G039201 25.09 0.8496

Potri.009G003200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.