Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22870 178 / 7e-57 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT1G08160 126 / 4e-36 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35980 85 / 4e-20 NHL10, YLS9, ATNHL10 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G06320 81 / 7e-19 NHL3 NDR1/HIN1-like 3 (.1) AT3G11650 76 / 6e-17 NHL2 NDR1/HIN1-like 2 (.1) AT5G53730 74 / 4e-16 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35460 71 / 4e-15 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G27260 71 / 5e-15 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G11660 71 / 6e-15 NHL1 NDR1/HIN1-like 1 (.1) AT1G65690 70 / 2e-14 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G154000 [exp] 81 / 2e-18 AT1G54540 242 / 1e-80 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.015G002400 [exp] 77 / 2e-17 AT5G53730 227 / 7e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G204300 [exp] 77 / 3e-17 AT2G35980 208 / 6e-68 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G067100 [exp] 77 / 3e-17 AT1G54540 203 / 3e-65 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.012G006000 [exp] 77 / 3e-17 AT5G53730 225 / 4e-75 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.015G148200 [exp] 77 / 3e-17 AT5G36970 227 / 2e-74 NDR1/HIN1-like 25 (.1) Potri.016G071600 [exp] 76 / 6e-17 AT2G35980 205 / 9e-67 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.012G145500 [exp] 75 / 3e-16 AT5G36970 238 / 2e-78 NDR1/HIN1-like 25 (.1) Potri.016G071500 [exp] 72 / 2e-15 AT3G11660 272 / 1e-93 NDR1/HIN1-like 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021404 [exp] 172 / 4e-54 AT5G22870 151 / 6e-46 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016161 [exp] 166 / 4e-52 AT5G22870 148 / 8e-45 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10041350 [exp] 136 / 2e-41 AT5G22870 94 / 3e-25 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10005216 [exp] 83 / 2e-19 AT2G27260 152 / 2e-45 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021287 [exp] 82 / 5e-19 AT2G35980 236 / 7e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016962 [exp] 81 / 2e-18 AT2G35980 237 / 3e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10007364 [exp] 77 / 1e-16 AT1G65690 267 / 6e-90 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10034173 [exp] 76 / 1e-16 AT2G27260 149 / 2e-44 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10031888 [exp] 76 / 1e-16 AT1G54540 236 / 2e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021288 [exp] 75 / 2e-16 AT2G35980 237 / 2e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [poplar] [flax] E-set PF03168 [poplar] [flax] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.009G003800.2 pacid=42770961 polypeptide=Potri.009G003800.2.p locus=Potri.009G003800 ID=Potri.009G003800.2.v4.1 annot-version=v4.1 ATGGCAAACTCAGCCCCGCCGCCACCAGCAGCCGGCCCATCACCAGCCTCGAAACTTGTTCGAATCATAGTTGTAGTCATACTAGCTTTAATTGTTCTTC TTGGTTTAGCAGTCCTCATCACTTGGCTAATAATCAAGCCCAAACAGCTTGTTTACAGGATTGATAGCGCGTCAGTCCACAATTTCAACCTCAAGAATAA CCACCTCAATGCCACGTTTGATCTTCTCATAAAAGCTCATAATCCTAATAGCAGGATCTCCGTATACTATGATCCAATCGAAGTGTCCGTGGCATATGAT GGTCAAACCATCGCGTTCAACACCCTCGAGCCATTCCATCAACCCCGTAGAAACGTGACTCGACTAGATGCTACACTTGTGGCTCGTGACGCGGCATTGT CAGGGGCTTTGTCCAGAGACTTGAGGGTTCAAAAAAGGTCAGGAAACATTGGATTGGATGTCAGAATCAAGGCAAGAATTCGGTTTAAGGTAGGAATATT CAAGCTGAAGCATCATACGTTAAGGATCTCATGCTCTCCAGTGAAAGTGCAAATGTCTTCATTAAAAAATTTCGAGACTGCTTCTTGTGATTTGGATTGG TAA
AA sequence Show only first row Show all	>Potri.009G003800.2 pacid=42770961 polypeptide=Potri.009G003800.2.p locus=Potri.009G003800 ID=Potri.009G003800.2.v4.1 annot-version=v4.1 MANSAPPPPAAGPSPASKLVRIIVVVILALIVLLGLAVLITWLIIKPKQLVYRIDSASVHNFNLKNNHLNATFDLLIKAHNPNSRISVYYDPIEVSVAYD GQTIAFNTLEPFHQPRRNVTRLDATLVARDAALSGALSRDLRVQKRSGNIGLDVRIKARIRFKVGIFKLKHHTLRISCSPVKVQMSSLKNFETASCDLDW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G22870			Late embryogenesis abundant (L...		Potri.009G003800 [exp]	0	1
AT1G54860			Glycoprotein membrane precurso...		Potri.005G034300 [exp]	2.23	0.9900
AT5G18970			AWPM-19-like family protein (....		Potri.008G200300 [exp]	3.74	0.9861
AT3G50120			Plant protein of unknown funct...		Potri.001G071400 [exp]	4.24	0.9847
AT3G17730	NAC	ANAC057	NAC domain containing protein ...		Potri.012G038100 [exp]	5.47	0.9829	NAC020
AT3G61172		LCR8	low-molecular-weight cysteine-...		Potri.016G061600 [exp]	6.63	0.9652
AT3G20570		AtENODL9	early nodulin-like protein 9 (...		Potri.011G135400 [exp]	7.34	0.9823
AT3G17730	NAC	ANAC057	NAC domain containing protein ...		Potri.015G030200 [exp]	7.93	0.9819	NAC017
AT1G23530			unknown protein		Potri.010G041600 [exp]	8.00	0.9840
					Potri.001G444350 [exp]	8.24	0.9547
					Potri.005G001001 [exp]	8.24	0.9685

Compare expression of checked genes

Potri.009G003800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.