Potri.009G004950 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00700 80 / 2e-22 ATCG00700.1, PSBN photosystem II reaction center protein N (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G113700 77 / 2e-21 ATCG00700 87 / 3e-25 photosystem II reaction center protein N (.1)
Potri.019G028300 77 / 2e-21 ATCG00700 87 / 3e-25 photosystem II reaction center protein N (.1)
Potri.007G062182 77 / 2e-21 ATCG00700 84 / 3e-24 photosystem II reaction center protein N (.1)
Potri.011G074784 76 / 9e-21 ATCG00700 85 / 1e-24 photosystem II reaction center protein N (.1)
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02468 PsbN Photosystem II reaction centre N protein (psbN)
Representative CDS sequence
>Potri.009G004950.1 pacid=42772204 polypeptide=Potri.009G004950.1.p locus=Potri.009G004950 ID=Potri.009G004950.1.v4.1 annot-version=v4.1
ATGGAAACAGCAACCCTAGTCACCATCTTTATATTTGGTTTACTTGTAAGTTTTACTGGGTATGCCTTATATACTGCTTTTGGGCAACCCTCTCAACAAC
TAAGAGATCCATTCAAGGAACACAGGTGA
AA sequence
>Potri.009G004950.1 pacid=42772204 polypeptide=Potri.009G004950.1.p locus=Potri.009G004950 ID=Potri.009G004950.1.v4.1 annot-version=v4.1
METATLVTIFIFGLLVSFTGYALYTAFGQPSQQLRDPFKEHR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00700 ATCG00700.1, PS... photosystem II reaction center... Potri.009G004950 0 1
AT1G42430 unknown protein Potri.002G011300 3.16 0.8819
ATCG00520 ATCG00520.1, YC... unfolded protein binding (.1) Potri.016G094067 9.16 0.9034
ATCG00530 ATCG00530.1, YC... CemA-like proton extrusion pro... Potri.016G094100 12.16 0.8918
AT1G11545 XTH8 xyloglucan endotransglucosylas... Potri.014G152700 13.85 0.8381
ATCG00500 ATCG00500.1, AC... acetyl-CoA carboxylase carboxy... Potri.013G162600 15.32 0.8917
ATCG00480 ATCG00480.1, AT... ATP synthase subunit beta (.1) Potri.013G162800 20.32 0.8896
ATCG00560 ATCG00560.1, PS... photosystem II reaction center... Potri.013G162100 20.56 0.8853
ATCG00480 ATCG00480.1, AT... ATP synthase subunit beta (.1) Potri.007G062122 22.58 0.8906
AT2G42040 unknown protein Potri.016G058000 28.98 0.7791
AT3G16520 UGT88A1 UDP-glucosyl transferase 88A1 ... Potri.004G069700 31.01 0.8175

Potri.009G004950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.