Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G28060 158 / 1e-51 5'-AMP-activated protein kinase beta-2 subunit protein (.1) AT4G16360 109 / 1e-30 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) AT5G21170 98 / 6e-26 AKINBETA1 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G213600 [exp] 220 / 4e-76 AT2G28060 156 / 8e-51 5'-AMP-activated protein kinase beta-2 subunit protein (.1) Potri.016G006400 [exp] 103 / 4e-28 AT4G16360 415 / 5e-148 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) Potri.001G220800 [exp] 100 / 7e-27 AT5G21170 316 / 1e-108 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2) Potri.006G005800 [exp] 100 / 2e-26 AT4G16360 408 / 3e-145 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) Potri.009G021600 [exp] 93 / 6e-24 AT5G21170 319 / 1e-109 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2) Potri.014G167400 [exp] 74 / 8e-17 AT4G16360 206 / 2e-65 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008427 [exp] 189 / 2e-63 AT2G28060 157 / 6e-51 5'-AMP-activated protein kinase beta-2 subunit protein (.1) Lus10003355 [exp] 186 / 1e-62 AT2G28060 150 / 2e-48 5'-AMP-activated protein kinase beta-2 subunit protein (.1) Lus10038783 [exp] 100 / 1e-26 AT4G16360 395 / 1e-139 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) Lus10039076 [exp] 100 / 3e-26 AT4G16360 392 / 2e-138 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) Lus10037424 [exp] 90 / 6e-23 AT5G21170 305 / 2e-104 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2) Lus10041287 [exp] 90 / 1e-22 AT5G21170 295 / 6e-100 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2) Lus10012343 [exp] 81 / 8e-20 AT4G16360 220 / 1e-72 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) Lus10006390 [exp] 77 / 4e-18 AT4G16360 222 / 3e-72 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04739 [poplar] [flax] AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Representative CDS sequence Show only first row Show all	>Potri.009G008700.3 pacid=42771352 polypeptide=Potri.009G008700.3.p locus=Potri.009G008700 ID=Potri.009G008700.3.v4.1 annot-version=v4.1 ATGAGCAACCAATTCAGTGAAGATAATGAAGATGCGACTGTTGCGGGATTTGAAGTTCCTAGATCACCTGATTCAAGTTACAACAATGCATATCCAGGGA ATGAAGATGAGGTACGGGACCCACCTTCAGTGCCTCCACACCTGCAACACTCGTTGCTTAGCTACCCTGCAAGTGCAGACTCTTCTGAAACGCTTCCACT GCCACAGAATGTGATTCTCAACCATCTTTACATTGAGAACCGGGAGACCCCACGTTCTGTGGTGGCACTCGGGTTCACTCATCGCTTCCATTCAAAATTT GTCACTGTTGTGCTATACAAACCTGTTCAAAGGAGGGGTAGTACCAGCACTTAG
AA sequence Show only first row Show all	>Potri.009G008700.3 pacid=42771352 polypeptide=Potri.009G008700.3.p locus=Potri.009G008700 ID=Potri.009G008700.3.v4.1 annot-version=v4.1 MSNQFSEDNEDATVAGFEVPRSPDSSYNNAYPGNEDEVRDPPSVPPHLQHSLLSYPASADSSETLPLPQNVILNHLYIENRETPRSVVALGFTHRFHSKF VTVVLYKPVQRRGSTST

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G28060			5'-AMP-activated protein kinas...		Potri.009G008700 [exp]	0	1
AT5G03290		IDH-V	isocitrate dehydrogenase V (.1...		Potri.006G126700 [exp]	2.44	0.7598
AT2G14110			Haloacid dehalogenase-like hyd...		Potri.017G043700 [exp]	4.00	0.7824
AT1G10630		ATARFA1F	ADP-ribosylation factor A1F (....		Potri.010G152600 [exp]	6.16	0.7611	Pt-ARF1.6
AT1G44960			SNARE associated Golgi protein...		Potri.001G070800 [exp]	8.94	0.7597
AT2G18630			Protein of unknown function (D...		Potri.005G127401 [exp]	10.81	0.7106
AT2G16460			Protein of unknown function (D...		Potri.009G123700 [exp]	20.39	0.7018
AT1G55805			BolA-like family protein (.1)		Potri.012G036800 [exp]	20.71	0.7181
AT1G52280		AtRABG3d	RAB GTPase homolog G3D (.1)		Potri.003G053400 [exp]	20.83	0.7275
AT5G22950		VPS24.1	SNF7 family protein (.1)		Potri.008G034700 [exp]	25.09	0.6603
AT2G04410			RPM1-interacting protein 4 (RI...		Potri.015G089201 [exp]	25.29	0.6846

Compare expression of checked genes

Potri.009G008700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.