Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G23280 103 / 1e-27 TCP TCP7 TCP family transcription factor (.1) AT5G08330 102 / 3e-27 TCP AtTCP11, CHE, TCP21 TCP domain protein 11, TCP family transcription factor (.1) AT1G72010 103 / 2e-26 TCP TCP22 TCP family transcription factor (.1) AT1G69690 99 / 4e-25 TCP AtTCP15, TCP15 TEOSINTE BRANCHED1/CYCLOIDEA/PCF 15, TCP family transcription factor (.1) AT1G35560 99 / 5e-25 TCP TCP23 TCP family transcription factor (.1) AT3G47620 100 / 1e-24 TCP AtTCP14, TCP14 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) AT1G58100 99 / 1e-24 TCP TCP8 TCP domain protein 8, TCP family transcription factor (.1.2) AT3G27010 97 / 2e-24 TCP ATTCP20, PCF1, AT-TCP20 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) AT2G45680 97 / 3e-24 TCP TCP9 TCP family transcription factor (.1) AT5G41030 95 / 4e-24 TCP TCP6 TCP family transcription factor (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G110700 [exp] 107 / 7e-28 AT1G35560 224 / 9e-70 TCP family transcription factor (.1) Potri.007G074028 [exp] 103 / 3e-27 AT5G23280 196 / 3e-62 TCP family transcription factor (.1) Potri.005G090300 [exp] 103 / 3e-27 AT5G23280 169 / 9e-52 TCP family transcription factor (.1) Potri.019G081800 [exp] 103 / 2e-26 AT1G72010 220 / 5e-68 TCP family transcription factor (.1) Potri.006G125800 [exp] 99 / 3e-26 AT2G37000 105 / 1e-28 TCP family transcription factor (.1) Potri.001G060000 [exp] 100 / 5e-26 AT3G27010 215 / 2e-68 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Potri.004G046300 [exp] 100 / 4e-25 AT3G47620 182 / 2e-52 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Potri.011G055500 [exp] 100 / 5e-25 AT3G47620 173 / 2e-49 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Potri.014G078500 [exp] 99 / 6e-25 AT2G45680 257 / 1e-83 TCP family transcription factor (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010177 [exp] 102 / 2e-26 AT5G23280 186 / 1e-57 TCP family transcription factor (.1) Lus10015760 [exp] 100 / 7e-26 AT3G27010 181 / 1e-55 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10037046 [exp] 96 / 7e-26 AT3G27010 145 / 5e-44 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10037190 [exp] 100 / 5e-25 AT1G69690 172 / 9e-50 TEOSINTE BRANCHED1/CYCLOIDEA/PCF 15, TCP family transcription factor (.1) Lus10032022 [exp] 97 / 2e-24 AT3G27010 234 / 2e-75 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10013814 [exp] 88 / 1e-21 AT3G47620 119 / 2e-32 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Lus10041328 [exp] 76 / 4e-17 AT3G47620 93 / 3e-22 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Lus10008621 [exp] 74 / 6e-16 AT3G47620 140 / 4e-38 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Lus10035193 [exp] 71 / 3e-15 AT3G27010 156 / 6e-47 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10008444 [exp] 56 / 1e-10 AT1G58100 104 / 5e-28 TCP domain protein 8, TCP family transcription factor (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03634 [poplar] [flax] TCP TCP family transcription factor
Representative CDS sequence Show only first row Show all	>Potri.009G009400.1 pacid=42772655 polypeptide=Potri.009G009400.1.p locus=Potri.009G009400 ID=Potri.009G009400.1.v4.1 annot-version=v4.1 ATGAACAAAGCAAGCACCTCAAAAACAAAGGTGACCGATCCCAAACCCAGGAAAGATCGCCATGCAAAGGTGAATGGCAGAGATCGTCGTATCCGCCTGC CAGTTAACTGTGCTGCTAGAGTATTTCAGTTGACTCAAGAGCTTGGTAACAAGACTGATGGTGAGACCATTGAGTGGCTTCTACGCGTGGCTGAGCCAAC CATCATTGCAGTCACAGGAAAAGGTATTGGTACGACCAATACTATTCGGGGTCATGCTCAAGCTGCTAGAGTCAACACAACATCGGTTTCATACTCCTCT GACCTACATCCACTAGTTTCTACAGGGCTTTCGAGTCCTCTTATGGATCCTTCTGAGCCAAGATATATGGAACCAATTCAAACCCAAGGATTGATTAGTC CGAACTGTGAGGTGTCTGCGGATGAACCACTGTCATTCCCTTCTGAGTTTGATAATCTGGAAACAAATTTTGACATGGAATTTCCTGTCAATGATATGTT TCCATCAGTGTCAGGGAACGATCATGAGGAATAG
AA sequence Show only first row Show all	>Potri.009G009400.1 pacid=42772655 polypeptide=Potri.009G009400.1.p locus=Potri.009G009400 ID=Potri.009G009400.1.v4.1 annot-version=v4.1 MNKASTSKTKVTDPKPRKDRHAKVNGRDRRIRLPVNCAARVFQLTQELGNKTDGETIEWLLRVAEPTIIAVTGKGIGTTNTIRGHAQAARVNTTSVSYSS DLHPLVSTGLSSPLMDPSEPRYMEPIQTQGLISPNCEVSADEPLSFPSEFDNLETNFDMEFPVNDMFPSVSGNDHEE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G23280	TCP	TCP7	TCP family transcription facto...		Potri.009G009400 [exp]	0	1
					Potri.006G229050 [exp]	2.23	0.7288
AT4G27330	NZZ	NZZ, SPL	NOZZLE, sporocyteless (SPL) (....		Potri.001G409000 [exp]	2.44	0.7051
AT1G57775			Protein of unknown function (D...		Potri.004G114901 [exp]	4.47	0.7296
AT5G16920			Fasciclin-like arabinogalactan...		Potri.016G009000 [exp]	5.19	0.6377
AT3G55550			Concanavalin A-like lectin pro...		Potri.006G252732 [exp]	11.53	0.4918
AT1G79400		ATCHX2	cation/H+ exchanger 2, cation/...		Potri.003G194100 [exp]	16.73	0.4668	ATCHX1.2
AT4G39640		GGT1	gamma-glutamyl transpeptidase ...		Potri.001G333400 [exp]	30.49	0.4329
AT3G04280		ARR22	response regulator 22 (.1.2.3)		Potri.003G172750 [exp]	33.86	0.4300
					Potri.010G121650 [exp]	34.40	0.4297
AT5G37820		NIP4;2, NLM5	NODULIN- 26-LIKE MAJOR INTRINS...		Potri.017G128200 [exp]	38.15	0.4377

Compare expression of checked genes

Potri.009G009400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.