Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60460 85 / 8e-23 Preprotein translocase Sec, Sec61-beta subunit protein (.1) AT2G45070 66 / 1e-15 SEC61 BETA, SEC61BETA SUPPRESSORS OF SECRETION-DEFECTIVE 61 BETA, Preprotein translocase Sec, Sec61-beta subunit protein (.1.2.3.4) AT3G60540 66 / 1e-15 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G143100 [exp] 65 / 4e-15 AT3G60540 86 / 1e-23 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Potri.014G059000 [exp] 65 / 4e-15 AT3G60540 81 / 7e-22 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036119 [exp] 94 / 3e-26 AT5G60460 108 / 6e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1) Lus10010009 [exp] 62 / 6e-14 AT3G60540 109 / 3e-33 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Lus10011428 [exp] 62 / 9e-14 AT3G60540 105 / 8e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Lus10037570 [exp] 62 / 9e-14 AT3G60540 105 / 8e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Lus10025029 [exp] 61 / 2e-13 AT3G60540 107 / 2e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03911 [poplar] [flax] Sec61_beta Sec61beta family
Representative CDS sequence Show only first row Show all	>Potri.009G012000.2 pacid=42771441 polypeptide=Potri.009G012000.2.p locus=Potri.009G012000 ID=Potri.009G012000.2.v4.1 annot-version=v4.1 ATGGCGAGAGGTGCTTCTCAATCGCAAACCACCTCCTCTTCTTCCTCTTCCCGTGCTGGAGTTGCGGCTCCTCGCGGCTCCGCCGCCGCCGCTGCTGGGA TGCGCCGCCGCCGCGTCTTATCCTCCGGATCCTCCTCCGGCGGTGGTAGCGGTAGCGGAATCGGAGCCCCTGGCGGCAACATGCTTCGATTCTACACCGA TGATGCGCCGGGCTTGAAGATCTCGCCCACGATAGTCCTGGTGATAAGTCTCTGCTTCATTGGCTTTGTCACTGCTCTCCATGTCTTTGGCAAGCTTTAT CGCAGCAAGGTTAGTCCCTGA
AA sequence Show only first row Show all	>Potri.009G012000.2 pacid=42771441 polypeptide=Potri.009G012000.2.p locus=Potri.009G012000 ID=Potri.009G012000.2.v4.1 annot-version=v4.1 MARGASQSQTTSSSSSSRAGVAAPRGSAAAAAGMRRRRVLSSGSSSGGGSGSGIGAPGGNMLRFYTDDAPGLKISPTIVLVISLCFIGFVTALHVFGKLY RSKVSP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G60460			Preprotein translocase Sec, Se...		Potri.009G012000 [exp]	0	1
AT1G09630		ATRAB-A2A, ATRA...	ARABIDOPSIS RAB GTPASE A2A, RA...		Potri.004G226400 [exp]	11.48	0.8567
AT1G60970			SNARE-like superfamily protein...		Potri.001G352900 [exp]	13.67	0.8296
AT2G42310			unknown protein		Potri.016G051400 [exp]	13.85	0.8663
AT4G32530			ATPase, F0/V0 complex, subunit...		Potri.006G248700 [exp]	16.24	0.8530
AT5G01090			Concanavalin A-like lectin fam...		Potri.006G094900 [exp]	18.46	0.8348
AT4G28088			Low temperature and salt respo...		Potri.006G182500 [exp]	26.60	0.8551
AT3G48750		CDKA1, CDC2A, C...	cell division control 2 (.1)		Potri.004G133500 [exp]	32.49	0.8347	Pt-CDC2.1,1
AT3G23325			Splicing factor 3B subunit 5/R...		Potri.010G070500 [exp]	32.86	0.7919
AT1G29690		CAD1	constitutively activated cell ...		Potri.016G135100 [exp]	42.00	0.7689
AT1G19910		AVA-2PE, ATVHA-...	VACUOLAR-TYPE H+ ATPASE C2, AT...		Potri.005G235300 [exp]	47.05	0.8383

Compare expression of checked genes

Potri.009G012000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.