Potri.009G013500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G45230 52 / 1e-08 hydroxyproline-rich glycoprotein family protein (.1)
AT5G60630 44 / 6e-06 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G210300 67 / 3e-14 AT3G45230 51 / 2e-08 hydroxyproline-rich glycoprotein family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021479 50 / 7e-08 AT3G45230 64 / 5e-13 hydroxyproline-rich glycoprotein family protein (.1)
Lus10022582 48 / 3e-07 AT3G45230 67 / 2e-14 hydroxyproline-rich glycoprotein family protein (.1)
Lus10037404 45 / 6e-06 AT3G45230 62 / 2e-12 hydroxyproline-rich glycoprotein family protein (.1)
PFAM info
Representative CDS sequence
>Potri.009G013500.2 pacid=42772706 polypeptide=Potri.009G013500.2.p locus=Potri.009G013500 ID=Potri.009G013500.2.v4.1 annot-version=v4.1
ATGGGTAGCATCACTGGATTAGTGCTTGTTTTAGCCTTGTTTTTATTGCAAATCTCCTCCTCCTCCGCGGAAACACCTGAACAGTCACCATCTCCATCTC
CATCTACCGAAGAATCCGCCGCCCCCGCCAATTCACCATTTCTATCTCCTCCTCTTCCATCTCCTTCACCAGAAACTGGATCTCCGTCAGATTCGCCGTT
GGCATCCCCACCAGCACCACCGCCTTCAGATCCGGTTCCGTCCGTTGTTCCAGGCTCAGCACCTGCATCAGCGCCGACGGAAGGGAGCGAGATCAATCAC
AGCAACAATGTGGAAGCAGGAAGTGGGGGTGAAGGGAGTGGGGGCGACGGAAGTGAGGGTGAAGGAGAATCGAAGGGAATGAGCGGAGGGAAGAAGGCGG
GGATAGTAGTGGGAGTGATAGTGGCGGCGTGTATGGTTGGATTTGGAGGATTGGTTTATAAGAAGAGACAAGATAACATTCGAAGGTCTGATTATGGTTA
TGCTGCTAGAAGAGAGATTCTCTGA
AA sequence
>Potri.009G013500.2 pacid=42772706 polypeptide=Potri.009G013500.2.p locus=Potri.009G013500 ID=Potri.009G013500.2.v4.1 annot-version=v4.1
MGSITGLVLVLALFLLQISSSSAETPEQSPSPSPSTEESAAPANSPFLSPPLPSPSPETGSPSDSPLASPPAPPPSDPVPSVVPGSAPASAPTEGSEINH
SNNVEAGSGGEGSGGDGSEGEGESKGMSGGKKAGIVVGVIVAACMVGFGGLVYKKRQDNIRRSDYGYAARREIL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G45230 hydroxyproline-rich glycoprote... Potri.009G013500 0 1
AT3G20560 ATPDI12, ATPDIL... ARABIDOPSIS THALIANA PROTEIN D... Potri.001G419300 3.00 0.9063
AT3G54950 pPLAIIIbeta, PL... patatin-related phospholipase ... Potri.015G122700 5.09 0.9110
AT3G42800 unknown protein Potri.018G065000 7.21 0.9074
AT2G40620 bZIP AtbZIP18 Basic-leucine zipper (bZIP) tr... Potri.013G156900 7.48 0.8925
AT5G11300 CYC2BAT, CYCA2;... CYCLIN A2;2, mitotic-like cycl... Potri.018G034100 8.06 0.8802 Pt-CYC3.1
AT4G10955 alpha/beta-Hydrolases superfam... Potri.001G090500 14.45 0.8888
AT4G30320 CAP (Cysteine-rich secretory p... Potri.018G096007 14.56 0.9057
Potri.001G297466 15.00 0.9012
AT1G28400 unknown protein Potri.011G057500 15.29 0.8975
AT3G06840 unknown protein Potri.001G162100 16.12 0.8889

Potri.009G013500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.