Potri.009G015600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G22050 318 / 9e-109 Protein kinase superfamily protein (.1.2)
AT3G19300 155 / 1e-42 Protein kinase superfamily protein (.1)
AT1G49730 145 / 3e-39 Protein kinase superfamily protein (.1.2.3.4)
AT1G76370 117 / 3e-30 Protein kinase superfamily protein (.1)
AT1G71830 119 / 6e-30 ATSERK1, SERK1 somatic embryogenesis receptor-like kinase 1 (.1)
AT5G02800 116 / 9e-30 CDL1 CDG1-like 1, Protein kinase superfamily protein (.1)
AT5G18610 117 / 1e-29 Protein kinase superfamily protein (.1.2)
AT1G20650 115 / 2e-29 ASG5 ALTERED SEED GERMINATION 5, Protein kinase superfamily protein (.1)
AT2G23950 116 / 4e-29 Leucine-rich repeat protein kinase family protein (.1)
AT1G34210 114 / 2e-28 ATSERK2, SERK2 somatic embryogenesis receptor-like kinase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G215000 494 / 2e-178 AT5G22050 355 / 3e-123 Protein kinase superfamily protein (.1.2)
Potri.004G140301 152 / 1e-41 AT1G49730 744 / 0.0 Protein kinase superfamily protein (.1.2.3.4)
Potri.009G100400 148 / 3e-40 AT3G19300 773 / 0.0 Protein kinase superfamily protein (.1)
Potri.002G009300 123 / 2e-32 AT1G20650 548 / 0.0 ALTERED SEED GERMINATION 5, Protein kinase superfamily protein (.1)
Potri.005G252000 121 / 2e-31 AT1G20650 531 / 0.0 ALTERED SEED GERMINATION 5, Protein kinase superfamily protein (.1)
Potri.010G021500 121 / 5e-31 AT5G18610 779 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.019G094700 121 / 1e-30 AT4G29990 652 / 0.0 Leucine-rich repeat transmembrane protein kinase protein (.1)
Potri.003G166900 117 / 1e-29 AT5G13160 745 / 0.0 avrPphB susceptible 1, Protein kinase superfamily protein (.1)
Potri.005G083300 117 / 2e-29 AT1G71830 981 / 0.0 somatic embryogenesis receptor-like kinase 1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013365 311 / 7e-106 AT5G22050 301 / 8e-102 Protein kinase superfamily protein (.1.2)
Lus10004110 273 / 3e-90 AT5G22050 274 / 1e-90 Protein kinase superfamily protein (.1.2)
Lus10014071 168 / 4e-47 AT3G19300 777 / 0.0 Protein kinase superfamily protein (.1)
Lus10019844 166 / 1e-46 AT3G19300 771 / 0.0 Protein kinase superfamily protein (.1)
Lus10030741 123 / 4e-32 AT1G20650 523 / 0.0 ALTERED SEED GERMINATION 5, Protein kinase superfamily protein (.1)
Lus10016021 116 / 1e-29 AT1G20650 516 / 0.0 ALTERED SEED GERMINATION 5, Protein kinase superfamily protein (.1)
Lus10012814 115 / 7e-29 AT5G18610 807 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10041426 114 / 8e-29 AT5G18610 582 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10033966 115 / 9e-29 AT5G18610 805 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10022129 115 / 1e-28 AT3G24550 474 / 3e-159 proline-rich extensin-like receptor kinase 1, proline extensin-like receptor kinase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence
>Potri.009G015600.1 pacid=42772318 polypeptide=Potri.009G015600.1.p locus=Potri.009G015600 ID=Potri.009G015600.1.v4.1 annot-version=v4.1
ATGGATCGCCTAATCCGCAAGATGAGGCCTTACCTTCTGGCTTGGCATCACCGATCTCGTTCTAGTCCAGAATCGTCAGTGAGGCGCTTCTCATACAAAG
ATATAAAGAGGGCGACGGATGGTTTTCATCGTATAATATATAGCAATTCTCATGGGGCTGCCTACAGGGCTAGATTTCAAGATGGTGAGGTTGCGTTGGT
AAAGGAAGTAAAAGACTTGAATCAAGGAAAGGACAATTTTTTAAAAGAAGTTCAACTTTTGGGGCAGTTGCATCATCGCCACCTTCTTGCACTTAAAGGC
TTTTCCACAGGACATAAGAGGTTGCTAGTGTATGACAACATAGAAATGGGAAGCTTGAAGGAACATCTCAATGATCCTCTTAAAACTCCCTTGAATTGGA
AAACAAGGTTACAAATAGCCATTGGTGTAGCAGCTGCTTTGGAATACTTGCTTCTCTTCAGTAACCCACCAGTATATCATGTTTCCATCAGCGCAAGTAA
CATAATGCTAGATGAAAACTACATCGCAAAGATCTCCGATGTCGGCCTTATTAATTCCGTTGGAGCTAATGTAACAGTGCCTCATTCCTCGAATTCAGAA
GATTGCATGGATCACACATTTGGAAACTTAACTTTTCAGCTTGGTGTGCTAATCCTGGAGCTGATAACTGGTCAATCATCAGAGAACGGAATCACGGATT
TAATCCAGTGGATCCAAGAGTCCCGTTATCGCAGTTCGATTCAGAAGATGATTGACCCGGATCTAGGAAACAATTATGACTCTAGAGAGCTTAAAAATCT
TCTAGCTGTAGCAAGATTGTGTATAAAATCTGGGGATAAGCCAAAATTCTCTATTCCCCAGATATTTAGGTATCTCCAGAAGAAAGCAGAAAACACATGT
AATTAG
AA sequence
>Potri.009G015600.1 pacid=42772318 polypeptide=Potri.009G015600.1.p locus=Potri.009G015600 ID=Potri.009G015600.1.v4.1 annot-version=v4.1
MDRLIRKMRPYLLAWHHRSRSSPESSVRRFSYKDIKRATDGFHRIIYSNSHGAAYRARFQDGEVALVKEVKDLNQGKDNFLKEVQLLGQLHHRHLLALKG
FSTGHKRLLVYDNIEMGSLKEHLNDPLKTPLNWKTRLQIAIGVAAALEYLLLFSNPPVYHVSISASNIMLDENYIAKISDVGLINSVGANVTVPHSSNSE
DCMDHTFGNLTFQLGVLILELITGQSSENGITDLIQWIQESRYRSSIQKMIDPDLGNNYDSRELKNLLAVARLCIKSGDKPKFSIPQIFRYLQKKAENTC
N

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G22050 Protein kinase superfamily pro... Potri.009G015600 0 1
AT5G26710 Glutamyl/glutaminyl-tRNA synth... Potri.013G000400 2.64 0.7550
AT1G28340 AtRLP4 receptor like protein 4 (.1) Potri.004G047300 10.39 0.6570
AT1G43850 SEU SEUSS transcriptional co-regul... Potri.007G109400 13.26 0.6782
AT5G09810 ACT2/7, ACT7 actin 7 (.1) Potri.011G148000 20.85 0.7124 ACT6
AT3G48425 DNAse I-like superfamily prote... Potri.015G088900 30.38 0.6805
AT4G30850 HHP2 heptahelical transmembrane pr... Potri.018G102400 30.74 0.7039
AT5G57100 Nucleotide/sugar transporter f... Potri.018G139500 31.30 0.6547
AT3G16230 Predicted eukaryotic LigT (.1.... Potri.001G186600 31.67 0.6749
AT3G58610 ketol-acid reductoisomerase (.... Potri.014G055100 32.63 0.7096
AT5G56590 O-Glycosyl hydrolases family 1... Potri.018G068600 36.66 0.7092

Potri.009G015600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.