Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G44160 597 / 0 Outer membrane OMP85 family protein (.1) AT3G48620 311 / 8e-105 Outer membrane OMP85 family protein (.1) AT5G19620 249 / 2e-76 TOC75-V, EMB213, TOC75, ATOEP80, OEP80 translocon at the outer envelope membrane of chloroplasts 75-V, EMBRYO DEFECTIVE 213, ARABIDOPSIS THALIANA OUTER ENVELOPE PROTEIN OF 80 KDA, outer envelope protein of 80 kDa (.1) AT3G46740 87 / 2e-18 MAR1, TOC75-III, TOC75 MODIFIER OF ARG1 1, translocon at the outer envelope membrane of chloroplasts 75-III (.1) AT4G09080 74 / 3e-14 TOC75-IV, ATTOC75-IV translocon at the outer envelope membrane of chloroplasts 75-IV, TRANSLOCON OUTER MEMBRANE COMPLEX 75-IV, Outer membrane OMP85 family protein (.1) AT1G35860 45 / 4e-05 TOC75-I translocon outer membrane complex 75-I (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G215500 [exp] 651 / 0 AT3G44160 581 / 0.0 Outer membrane OMP85 family protein (.1) Potri.003G204900 [exp] 248 / 5e-76 AT5G19620 892 / 0.0 translocon at the outer envelope membrane of chloroplasts 75-V, EMBRYO DEFECTIVE 213, ARABIDOPSIS THALIANA OUTER ENVELOPE PROTEIN OF 80 KDA, outer envelope protein of 80 kDa (.1) Potri.001G019000 [exp] 245 / 4e-75 AT5G19620 936 / 0.0 translocon at the outer envelope membrane of chloroplasts 75-V, EMBRYO DEFECTIVE 213, ARABIDOPSIS THALIANA OUTER ENVELOPE PROTEIN OF 80 KDA, outer envelope protein of 80 kDa (.1) Potri.003G158100 [exp] 84 / 2e-17 AT3G46740 1274 / 0.0 MODIFIER OF ARG1 1, translocon at the outer envelope membrane of chloroplasts 75-III (.1) Potri.001G072800 [exp] 82 / 9e-17 AT3G46740 1289 / 0.0 MODIFIER OF ARG1 1, translocon at the outer envelope membrane of chloroplasts 75-III (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013360 [exp] 550 / 0 AT3G44160 574 / 0.0 Outer membrane OMP85 family protein (.1) Lus10004104 [exp] 536 / 0 AT3G44160 566 / 0.0 Outer membrane OMP85 family protein (.1) Lus10031839 [exp] 234 / 7e-71 AT5G19620 1030 / 0.0 translocon at the outer envelope membrane of chloroplasts 75-V, EMBRYO DEFECTIVE 213, ARABIDOPSIS THALIANA OUTER ENVELOPE PROTEIN OF 80 KDA, outer envelope protein of 80 kDa (.1) Lus10031272 [exp] 224 / 8e-67 AT5G19620 1018 / 0.0 translocon at the outer envelope membrane of chloroplasts 75-V, EMBRYO DEFECTIVE 213, ARABIDOPSIS THALIANA OUTER ENVELOPE PROTEIN OF 80 KDA, outer envelope protein of 80 kDa (.1) Lus10004978 [exp] 83 / 3e-17 AT3G46740 1117 / 0.0 MODIFIER OF ARG1 1, translocon at the outer envelope membrane of chloroplasts 75-III (.1) Lus10001566 [exp] 82 / 1e-16 AT3G46740 1210 / 0.0 MODIFIER OF ARG1 1, translocon at the outer envelope membrane of chloroplasts 75-III (.1) Lus10016508 [exp] 82 / 1e-16 AT3G46740 1179 / 0.0 MODIFIER OF ARG1 1, translocon at the outer envelope membrane of chloroplasts 75-III (.1) Lus10040775 [exp] 45 / 4e-05 AT3G46740 471 / 7e-161 MODIFIER OF ARG1 1, translocon at the outer envelope membrane of chloroplasts 75-III (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0193 [poplar] [flax] MBB PF01103 [poplar] [flax] Omp85 Omp85 superfamily domain
Representative CDS sequence Show only first row Show all	>Potri.009G017100.2 pacid=42771053 polypeptide=Potri.009G017100.2.p locus=Potri.009G017100 ID=Potri.009G017100.2.v4.1 annot-version=v4.1 ATGGGAGCTCAAAAGAGCATCCATGCTGGCAAAGCCAAGATTGATGTGAATGTTGATTTTACTCACAAGCTATGTGCTTCTTTGATGCTTCCTTCTCTAA GGAACACTGGAAGTCCTCTTTCTCTGATAATTGGGAGTCTTTGCATCAAACACCCGAATTTATTTGGTGGAAGTGAGAAGCTTGATGTATCATGGGATAA GGGGCTCTCTGATTCAAATGTCTCAATAACTTATAGAAGGCCAAGACCTGAGTGGCTTTGTCAAAAATGTTTTGTTATTCAGCATTCCTTTTCACCTGAA ATTGGGGTCCATGGTACACCAATCGACAATTTCTCTCGTTCAGGGAGTGGAGATGTAAATTTGTCTCGTTTATCAGTTGGTTTGGATCGAAATGAGCCTG CAAGCTCTGACTGGAGCAGCAGCACCAGTATCAAATTTGAGCATGTCCAACTAGTGAATGATGATGGACGCTCTATAACCAGGGACATTGATGGGTTCCC AGTGACATGCAGTGGCAGTCCCCATGACAGTATGCTAGTTTTGAAGCAAGAGTCTCAGTGTGCAAAGGCAAATGATCACAGTTTTTCTCGGTTTAGTATG CAAATTGAACAAGGGATTCCTATTCTATCAAAGTGGCTAATCTTCAACAAGTTCAAATTTACTGCTACAAAAGGAGTCAAACTTGGACCAGCATTTTTAT TGGCAAGCCTGACAGGTGGTTCCATTGTAGGAGACATGGCTCCTTACCAAGCATTTGCAATTGGAGGGCTTGGTAGTGTGCGAGGATATGGTGAGGGTGC TGTTGGATCCGGAAGATCATGTCTGGTTGGAAATAGTGAATTGACATTTCCTCTGAGTAAGATGTTGGAAGGTGCTTTTTTCGTGGACTGTGGAACTGAT CTGGGATCTGGTCGTCTTGTACCTGGAAATCCAGCAATGAGGCAGGGAAAACCGGGATCCGGAGTTGGGCTTGGATATGGCCTTCGTTTCAAGTCTCCAG CTGGTCATTTTCAGGTTGACTACGCCATCAATTCCTTTCAACAAAAAACTGTCTACTTTGGCATCAGCAACCTAATTTGA
AA sequence Show only first row Show all	>Potri.009G017100.2 pacid=42771053 polypeptide=Potri.009G017100.2.p locus=Potri.009G017100 ID=Potri.009G017100.2.v4.1 annot-version=v4.1 MGAQKSIHAGKAKIDVNVDFTHKLCASLMLPSLRNTGSPLSLIIGSLCIKHPNLFGGSEKLDVSWDKGLSDSNVSITYRRPRPEWLCQKCFVIQHSFSPE IGVHGTPIDNFSRSGSGDVNLSRLSVGLDRNEPASSDWSSSTSIKFEHVQLVNDDGRSITRDIDGFPVTCSGSPHDSMLVLKQESQCAKANDHSFSRFSM QIEQGIPILSKWLIFNKFKFTATKGVKLGPAFLLASLTGGSIVGDMAPYQAFAIGGLGSVRGYGEGAVGSGRSCLVGNSELTFPLSKMLEGAFFVDCGTD LGSGRLVPGNPAMRQGKPGSGVGLGYGLRFKSPAGHFQVDYAINSFQQKTVYFGISNLI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G44160			Outer membrane OMP85 family pr...		Potri.009G017100 [exp]	0	1
AT5G12240			unknown protein		Potri.009G069000 [exp]	5.83	0.8354
AT5G21222			protein kinase family protein ...		Potri.014G161400 [exp]	6.70	0.8098
AT4G28830			S-adenosyl-L-methionine-depend...		Potri.018G083800 [exp]	7.48	0.7929
AT2G16370		THY-1	thymidylate synthase 1 (.1)		Potri.005G230700 [exp]	8.48	0.7927	DHFR-TS-3b
AT4G29080	AUX_IAA	IAA27, PAP2	indole-3-acetic acid inducible...		Potri.006G161400 [exp]	9.16	0.7372
AT5G65380			MATE efflux family protein (.1...		Potri.005G160700 [exp]	11.22	0.8295
AT2G22540	MADS	AGL22, SVP	SHORT VEGETATIVE PHASE, AGAMOU...		Potri.002G105600 [exp]	12.40	0.7764
AT5G07900			Mitochondrial transcription te...		Potri.004G012900 [exp]	12.72	0.7669
AT1G65650		UCH2	Peptidase C12, ubiquitin carbo...		Potri.004G130400 [exp]	13.41	0.8114
AT3G59300			Pentatricopeptide repeat (PPR)...		Potri.014G151700 [exp]	16.06	0.8001

Compare expression of checked genes

Potri.009G017100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.