Potri.009G018800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G21090 355 / 5e-126 Leucine-rich repeat (LRR) family protein (.1)
AT3G43740 345 / 5e-122 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2)
AT1G71830 227 / 5e-71 ATSERK1, SERK1 somatic embryogenesis receptor-like kinase 1 (.1)
AT4G33430 223 / 2e-69 SERK3, RKS10, ELG, BAK1, ATSERK3, ATBAK1 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2)
AT1G34210 219 / 5e-68 ATSERK2, SERK2 somatic embryogenesis receptor-like kinase 2 (.1)
AT2G13790 211 / 6e-65 BAK7, BKK1, ATSERK4 BAK1-LIKE 1, BRI1- ASSOCIATED KINASE 7, somatic embryogenesis receptor-like kinase 4 (.1)
AT2G13800 198 / 3e-60 BAK8, ATSERK5 BRI1- ASSOCIATED KINASE 8, SOMATIC EMBRYOGENESIS RECEPTOR LIKE KINASE 5, somatic embryogenesis receptor-like kinase 5 (.1)
AT5G16000 130 / 4e-35 NIK1 NSP-interacting kinase 1 (.1)
AT3G25560 130 / 5e-35 NIK2 NSP-interacting kinase 2 (.1.2.3)
AT4G30520 129 / 2e-34 SARK SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE, Leucine-rich repeat protein kinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G219500 382 / 7e-137 AT5G21090 348 / 2e-123 Leucine-rich repeat (LRR) family protein (.1)
Potri.003G166200 274 / 5e-94 AT5G21090 275 / 2e-94 Leucine-rich repeat (LRR) family protein (.1)
Potri.001G061600 271 / 4e-93 AT5G21090 272 / 2e-93 Leucine-rich repeat (LRR) family protein (.1)
Potri.001G296500 271 / 6e-93 AT3G43740 278 / 1e-95 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2)
Potri.009G090700 262 / 2e-89 AT3G43740 270 / 2e-92 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2)
Potri.003G023000 226 / 8e-71 AT4G33430 961 / 0.0 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2)
Potri.013G117200 223 / 3e-69 AT1G34210 1013 / 0.0 somatic embryogenesis receptor-like kinase 2 (.1)
Potri.005G083300 222 / 5e-69 AT1G71830 981 / 0.0 somatic embryogenesis receptor-like kinase 1 (.1)
Potri.007G082400 221 / 9e-69 AT1G34210 954 / 0.0 somatic embryogenesis receptor-like kinase 2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002117 271 / 8e-93 AT3G43740 273 / 9e-94 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2)
Lus10002579 270 / 2e-92 AT5G21090 275 / 3e-94 Leucine-rich repeat (LRR) family protein (.1)
Lus10026751 256 / 1e-87 AT5G21090 250 / 2e-85 Leucine-rich repeat (LRR) family protein (.1)
Lus10013902 277 / 3e-87 AT1G49870 454 / 2e-145 unknown protein
Lus10001807 219 / 2e-72 AT5G21090 227 / 9e-76 Leucine-rich repeat (LRR) family protein (.1)
Lus10020962 226 / 2e-70 AT4G33430 989 / 0.0 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2)
Lus10004958 206 / 2e-67 AT1G34210 215 / 2e-66 somatic embryogenesis receptor-like kinase 2 (.1)
Lus10042755 200 / 6e-65 AT5G21090 199 / 8e-65 Leucine-rich repeat (LRR) family protein (.1)
Lus10028716 192 / 1e-57 AT1G71830 1000 / 0.0 somatic embryogenesis receptor-like kinase 1 (.1)
Lus10006057 144 / 6e-40 AT1G71830 954 / 0.0 somatic embryogenesis receptor-like kinase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0022 LRR PF00560 LRR_1 Leucine Rich Repeat
CL0022 PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
CL0022 LRR PF13855 LRR_8 Leucine rich repeat
Representative CDS sequence
>Potri.009G018800.2 pacid=42772534 polypeptide=Potri.009G018800.2.p locus=Potri.009G018800 ID=Potri.009G018800.2.v4.1 annot-version=v4.1
ATGGCTGCACAGGCATGGCTATGGACAAGTCTAACTGTTGCGTTGACTTTTATTTTGACAGTGGTCAATGGTAACTCAGAAGGAGATGCCTTGTTCACAC
TAAGAAAGAGCTTATCGGATCCGGATAATGTCCTCCAGAGCTGGGATCCGACTCTTGTTAACCCGTGTACTTGGTTTCACATCACTTGCAACCAGGATAA
TCGCGTCACTCGCCTGGACTTGGGAAACTCAAATCTATCTGGACATCTAGTACCTGAACTTGGAAAGCTAGAGCATTTGCAATACCTGGAACTTTATAAA
AACAACATTCAAGGAACTATCCCCAGTGAGCTAGGTAGCTTGAAGAGCCTTATTAGCTTGGACTTGTATAACAACAACATTTCAGGAACCATTCCTCCTT
CCCTGGGGAGGTTGAAGTCTCTTGTCTTTCTACGACTTAATGACAACCGATTAACTGGATCAATCCCCAGGGAACTTTCCAATGTTTCAAGCCTCAAAGT
TGTGGATGTCTCAAACAATGATTTATGTGGAACAATTCCTACCAGTGGACCTTTTGAACACATCCCTTTGAACAACTTTGAGAATAATCCTCGACTGGAA
GGTCCCGAGTTGCTTGGACTTGCGAGTTATGACACAAACTGCTCATGA
AA sequence
>Potri.009G018800.2 pacid=42772534 polypeptide=Potri.009G018800.2.p locus=Potri.009G018800 ID=Potri.009G018800.2.v4.1 annot-version=v4.1
MAAQAWLWTSLTVALTFILTVVNGNSEGDALFTLRKSLSDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRLDLGNSNLSGHLVPELGKLEHLQYLELYK
NNIQGTIPSELGSLKSLISLDLYNNNISGTIPPSLGRLKSLVFLRLNDNRLTGSIPRELSNVSSLKVVDVSNNDLCGTIPTSGPFEHIPLNNFENNPRLE
GPELLGLASYDTNCS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G21090 Leucine-rich repeat (LRR) fami... Potri.009G018800 0 1
AT5G17060 ATARFB1B ADP-ribosylation factor B1B (.... Potri.013G088800 11.48 0.6989
AT4G38790 ER lumen protein retaining rec... Potri.004G167400 18.43 0.6889
AT3G16090 AtHrd1A homolog of yeast Hrd1, RING/U-... Potri.019G051500 22.44 0.6454
AT1G68920 bHLH bHLH049, ACE1 basic helix-loop-helix (bHLH) ... Potri.008G113200 30.16 0.6650
AT1G61240 Protein of unknown function (D... Potri.004G036800 40.21 0.6868
AT5G40710 C2H2ZnF zinc finger (C2H2 type) family... Potri.001G336500 41.41 0.6557
Potri.016G124300 42.47 0.6601
AT4G16143 IMPA-2 importin alpha isoform 2 (.1.2... Potri.008G214100 44.15 0.6773
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Potri.006G022800 49.14 0.6720
AT3G07550 RNI-like superfamily protein (... Potri.017G056400 54.69 0.6656

Potri.009G018800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.