Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52580 241 / 3e-83 Ribosomal protein S11 family protein (.1) AT3G11510 239 / 1e-82 Ribosomal protein S11 family protein (.1) AT2G36160 237 / 1e-81 Ribosomal protein S11 family protein (.1) ATCG00750 55 / 3e-10 ATCG00750.1, RPS11 ribosomal protein S11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G218700 [exp] 253 / 7e-88 AT3G52580 241 / 4e-83 Ribosomal protein S11 family protein (.1) Potri.011G080500 [exp] 250 / 9e-87 AT3G52580 238 / 4e-82 Ribosomal protein S11 family protein (.1) Potri.004G131800 [exp] 249 / 2e-86 AT3G52580 235 / 7e-81 Ribosomal protein S11 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022693 [exp] 235 / 2e-79 AT3G11510 261 / 2e-89 Ribosomal protein S11 family protein (.1) Lus10021315 [exp] 236 / 1e-76 AT3G52570 397 / 2e-136 alpha/beta-Hydrolases superfamily protein (.1) Lus10016992 [exp] 234 / 1e-75 AT3G52570 433 / 1e-150 alpha/beta-Hydrolases superfamily protein (.1) Lus10014220 [exp] 209 / 9e-68 AT3G11510 236 / 4e-78 Ribosomal protein S11 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0267 [poplar] [flax] S11_L18p PF00411 [poplar] [flax] Ribosomal_S11 Ribosomal protein S11
Representative CDS sequence Show only first row Show all	>Potri.009G019400.3 pacid=42772035 polypeptide=Potri.009G019400.3.p locus=Potri.009G019400 ID=Potri.009G019400.3.v4.1 annot-version=v4.1 ATGTCGAGGAGAAAGACAAGAGAGCCAAAGGAAGAGAATGTTACACTTGGCCCAACTGTAAGGGAGGGAGAGCATGTTTTCGGGGTGGCTCACATTTTTG CTTCCTTTAATGATACCTTTATTCATGTGACTGATTTATCTGGGAGGGAAACCCTGGTTCGTATTACTGGTGGAATGAAGGTTAAAGCTGACAGGGATGA ATCTTCACCATATGCTGCTATGCTTGCTGCACAGGATGTTTCACAGAGATGCAAGGAACTTGGCATTACTGCTCTTCACATCAAGCTGCGTGCTACAGGA GGTAACAAAACTAAGACCCCTGGTCCAGGTGCTCAGTCTGCTCTGAGGGCATTGGCTCGTTCTGGAATGAAAATTGGTCGTATTGAGGACGTCACACCAA TTCCTACTGACAGCACCCGCAGAAAGGGTGGAAGAAGGGGTAGAAGGCTGTAA
AA sequence Show only first row Show all	>Potri.009G019400.3 pacid=42772035 polypeptide=Potri.009G019400.3.p locus=Potri.009G019400 ID=Potri.009G019400.3.v4.1 annot-version=v4.1 MSRRKTREPKEENVTLGPTVREGEHVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDVSQRCKELGITALHIKLRATG GNKTKTPGPGAQSALRALARSGMKIGRIEDVTPIPTDSTRRKGGRRGRRL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G52580			Ribosomal protein S11 family p...		Potri.009G019400 [exp]	0	1
AT2G27530		PGY1	PIGGYBACK1, Ribosomal protein ...		Potri.004G202832 [exp]	1.73	0.9792
AT4G36130			Ribosomal protein L2 family (....		Potri.005G115700 [exp]	2.82	0.9677	RPL2.2
AT5G48760			Ribosomal protein L13 family p...		Potri.001G314500 [exp]	4.58	0.9628	RPL13.1
AT3G11940		AML1, ATRPS5A	ARABIDOPSIS MINUTE-LIKE 1, rib...		Potri.006G197700 [exp]	5.91	0.9645	RPS5.2
AT5G61170			Ribosomal protein S19e family ...		Potri.017G092200 [exp]	7.34	0.9616	Pt-RPS19.2
AT3G02560			Ribosomal protein S7e family p...		Potri.004G099200 [exp]	8.24	0.9649
AT5G02610			Ribosomal L29 family protein ...		Potri.008G048800 [exp]	8.48	0.9628	RPL35.1
AT3G02560			Ribosomal protein S7e family p...		Potri.017G115400 [exp]	8.66	0.9655
AT3G02560			Ribosomal protein S7e family p...		Potri.016G100400 [exp]	10.58	0.9620
AT4G15000			Ribosomal L27e protein family ...		Potri.006G021500 [exp]	10.95	0.9455	Pt-RPL27.2

Compare expression of checked genes

Potri.009G019400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.