Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24070 67 / 3e-14 Peroxidase superfamily protein (.1) AT4G33870 62 / 2e-12 Peroxidase superfamily protein (.1) AT2G43480 61 / 3e-12 Peroxidase superfamily protein (.1) AT4G26010 60 / 6e-12 Peroxidase superfamily protein (.1) AT1G05250 60 / 8e-12 Peroxidase superfamily protein (.1) AT1G05240 60 / 8e-12 Peroxidase superfamily protein (.1) AT5G17820 59 / 2e-11 Peroxidase superfamily protein (.1) AT5G22410 58 / 3e-11 RHS18 root hair specific 18 (.1) AT5G06730 55 / 4e-10 Peroxidase superfamily protein (.1) AT3G01190 55 / 5e-10 Peroxidase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G218450 [exp] 90 / 9e-23 AT5G22410 280 / 1e-92 root hair specific 18 (.1) Potri.001G218500 [exp] 90 / 9e-23 AT5G22410 280 / 1e-92 root hair specific 18 (.1) Potri.015G110200 [exp] 69 / 6e-15 AT5G22410 340 / 1e-116 root hair specific 18 (.1) Potri.004G144600 [exp] 65 / 1e-13 AT1G49570 400 / 8e-140 Peroxidase superfamily protein (.1) Potri.009G106400 [exp] 62 / 8e-13 AT1G49570 429 / 2e-151 Peroxidase superfamily protein (.1) Potri.001G011200 [exp] 60 / 6e-12 AT3G49120 381 / 2e-132 PEROXIDASE 34, ARABIDOPSIS THALIANA PEROXIDASE CB, peroxidase CB (.1) Potri.003G053700 [exp] 60 / 9e-12 AT4G33870 234 / 7e-73 Peroxidase superfamily protein (.1) Potri.015G003600 [exp] 59 / 1e-11 AT1G05260 285 / 6e-95 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Potri.001G012901 [exp] 59 / 2e-11 AT5G06730 387 / 1e-134 Peroxidase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004859 [exp] 74 / 6e-17 AT5G22410 309 / 1e-104 root hair specific 18 (.1) Lus10032511 [exp] 64 / 3e-13 AT5G22410 302 / 8e-102 root hair specific 18 (.1) Lus10043010 [exp] 64 / 4e-13 AT5G22410 300 / 9e-101 root hair specific 18 (.1) Lus10025586 [exp] 61 / 4e-12 AT5G24070 418 / 6e-147 Peroxidase superfamily protein (.1) Lus10012684 [exp] 60 / 8e-12 AT2G41480 395 / 2e-138 Peroxidase superfamily protein (.1) Lus10005679 [exp] 60 / 1e-11 AT4G26010 353 / 3e-122 Peroxidase superfamily protein (.1) Lus10028688 [exp] 58 / 4e-11 AT4G11290 265 / 5e-87 Peroxidase superfamily protein (.1) Lus10028736 [exp] 58 / 4e-11 AT1G05260 266 / 4e-88 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Lus10020826 [exp] 58 / 5e-11 AT2G41480 375 / 1e-130 Peroxidase superfamily protein (.1) Lus10022962 [exp] 57 / 8e-11 AT5G24070 293 / 1e-99 Peroxidase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0617 [poplar] [flax] Peroxidase PF00141 [poplar] [flax] peroxidase Peroxidase
Representative CDS sequence Show only first row Show all	>Potri.009G019501.1 pacid=42771681 polypeptide=Potri.009G019501.1.p locus=Potri.009G019501 ID=Potri.009G019501.1.v4.1 annot-version=v4.1 ATGATTGTGATGATGAAATTATATCTTCCATCTCCAGATATCCCAATTGATAAGGCTGTTCAAGCATTTAAAAATAAAGGACTGAATGCTACAGGCATGG TTTATCTTCCTGGAGGTGGTCACAGTGTTGGGATAGCACCTTGTGTTGCATTCGAAAATCGTCTTTATGATTTCCAGAACACTGGCAAACCTGACCCAAC CATGAATACAACATTACTGAAAACCCTAAAAAAACTCTTTGTCCACGAAATTCTGGCGGTAGCAACTCAGCTAATCTCCTCCAGAATCCTCGTGGTTCTT CTGTAG
AA sequence Show only first row Show all	>Potri.009G019501.1 pacid=42771681 polypeptide=Potri.009G019501.1.p locus=Potri.009G019501 ID=Potri.009G019501.1.v4.1 annot-version=v4.1 MIVMMKLYLPSPDIPIDKAVQAFKNKGLNATGMVYLPGGGHSVGIAPCVAFENRLYDFQNTGKPDPTMNTTLLKTLKKLFVHEILAVATQLISSRILVVL L

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G24070			Peroxidase superfamily protein...		Potri.009G019501 [exp]	0	1
					Potri.001G269850 [exp]	1.41	0.8400
					Potri.019G045532 [exp]	6.70	0.7939
					Potri.019G045466 [exp]	8.66	0.8112
AT5G14950		GMII, ATGMII	golgi alpha-mannosidase II (.1...		Potri.001G350400 [exp]	13.11	0.8288
AT3G04980			DNAJ heat shock N-terminal dom...		Potri.013G029500 [exp]	34.29	0.7882
AT2G03360			Glycosyltransferase family 61 ...		Potri.010G162200 [exp]	37.46	0.7720
AT5G04010			F-box family protein (.1)		Potri.004G077301 [exp]	38.92	0.7658
AT3G56030			Tetratricopeptide repeat (TPR)...		Potri.008G141700 [exp]	40.69	0.7568
AT5G06350			ARM repeat superfamily protein...		Potri.011G095700 [exp]	59.89	0.7676
AT2G26100			Galactosyltransferase family p...		Potri.018G053150 [exp]	66.18	0.7604

Compare expression of checked genes

Potri.009G019501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.